Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022538 (Lsg1)
Chromosomal location
Chr 16: 30560580 - 30587678 (-)
Description
large subunit GTPase 1 homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Lsg1-001]
RefSeq_dna
NM_178069 
RefSeq_peptide
NP_835170.1 
UniGene
Mm.567 
MGI
MGI:107236 
Uniprot/SWISSPROT
Q3UM18 
Human Ortholog
ENSG00000041802 (LSG1)
Omim not available
UniTrap UNI7193
Vector Insertion
Chr 16: 30585767 - 30587523
Public Clones RRU488 (baygenomics) IST14669B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22830
Vector Insertion
Chr 16: 30582229 - 30582616
Public Clones not available
Private Clones OST283666 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22906
Vector Insertion
Chr 16: 30581132 - 30582141
Public Clones not available
Private Clones OST281548 (lexicon) OST182969 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27827
Vector Insertion
Chr 16: 30565596 - 30567796
Public Clones not available
Private Clones OST46975 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16437
Vector Insertion
Chr 16: 30561949 - 30564731
Public Clones (ggtc) PST23477-NR (escells) PST17719-NR (escells) PST20084-NR (escells)
PST17328-NR (escells) PST24133-NL (escells) PST21971-NR (escells)
Private Clones OST461331 (lexicon) OST460887 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117363
Sequence
GGAGAAACCGGAAGCCTCGCGTGCTGAGCAGTGGTTTGTGCTGTTGATGCGTGGTTATGGGTCGGAGACGAGCGCCGGGTGGTGGGTCCCTGGGCCGAGT

ACTTATCCGGCAGCAGACTCAGCGAAGCCGCAGCCACCGTCATACTGACTCCTGG - UNI7193 - CTGCATACAAGTGAACTCAATGATGGCTATGA

CTGGGGTCGTCTGAATCTTCAGTCTGTGACAGAGCAGAGCTCCCTGGAGGACTTTCTTGCAACTGCAGAACTTGCAGGGACCGAGTTTGTGGCTG AGAA

GCTGAATATTAAGTTTGTACCCCCTGAGGCTAGAACCGGACTGCTGTCTTTTGAGGAGAGCCAGAGAATTAAGAAACTCCACGAAGAAAACAGACAGTTC

TTGTGTATACCAAGGAG - UNI22830 - GCCAAATTGGGACAGAAAAACTAGCCCAGAAGAACTGAAACAAGCAGAGAAAGATAACTTCCTGAAATG

GAGGCGCCAGCTTGTGCG - UNI22906 - GCTAGAAGAGGAACAGAAGTTGATATTGACTCCCTTTGAACGGAACTTGGACTTCTGGCGCCAGCTCT

GGAGGGTCATTGAGAGAAG TGATATTGTGGTCCAGATCGTAGATGCTCGAAACCCGCTCCTGTTTAGATGTGAGGATTTG GAGTGTTACGTGAAAGAG

ATCGATGCTGCCAAGGAGAACGTGATCCTGATAAACAAGGCAGACTTGCTGACTGCTGAGCAGCGGTTTGCCTGGGCTGTGCACTTTGAAAAGGAAGGGG

TAAAGGTTATCTTCTGGTCAGCTTTGGCAGAAACTGATCACCTAAATGGTGACTTGAAG GAGGAAGTAGACAGTGTTGCTGGAGACACCAACAAAACAG

AGTCTGAAAGCTCCAGTTTGGATGCGAATGAAATCCCACACAGAGACTTGATCTCGCTTAGTGAGGAGTCCGCAAGTGACAGTGGTGACAGCAAATATGA

GGACTGTCAGGAGGACGAAGAGGAAGATTGGCAGACGTGTTCAGAAGAAGACAGCGTCCCTGAGGAGGAGGAGGGCTGTAATGCGGATTCTGAGACTCAG

AACAGAAAAAACGCAGAAAATCAACAAGTGAACAATGATAGCTACCTGGTGTCGAAACAGGAATTACTGGAACTCTTTAAGAAACTCCACACTGGAAAGA

AAGTGAAAGATGGACAGCTAACTGTTGGGCTG GTGGGCTACCCTAATGTTGGTAAGAGCTCAACCATCAACACCATCATGGGCAACAAGAAAGTATCGG

TGTCTGCCACGCCAGGCCACACCAAGCATTTCCAG ACCCTGTACGTGGAGCCTGGCCTCTGCCTGTGTGACTGCCCGGGCCTGGTGATGCCATCTTTCG

TGTCCACCAAAGCAGAGATGATTTGCAATGGGATCCTCCCTATCGACCAGATGAGAGACCACGTTCCACCC ATTT TTTACGTTTGCCAGAATATCCCA

CGGCGAGTTTTGGAAGTGACATATGGTATTAACATTATAAAGCCTAGAGAAGATGAAGACCCCTACCGACCTCCAACCTCAGAAGAACTGTTGACGGCTT

ATGGAT - UNI27827 - GCATGAGAGGATTCATGACAGCACATGGGCAGCCAGACCAGCCTCGATCTGCACGGTACATCCTAAAGGACTATGTTGGA

 GGTAAACTACTGTATTGCCACCCTCCTCCTGGAAAAGACCCTGTGGCGTTCCAGCACCAACACCAGCAGCTCCTAGAGAGCAAAGTAAAAGGTGGAGAA

CTGAGACTTCAGCCGGGCAAAGGCCGAAAAGCCAAACAGATCGAAAATGTAGTCGACAAAACTTTTTTCCATCAG - UNI16437 - GAGAACGTCAG

AGCACTGACCAAAGGTGTCCAGGCTGTCATGGGTTACAAGCCCGGGCATGGCCTGGTGACTGCGGCTGCTGCGAGCGCTGAGAATGTACCTGGGAAGCCC

TGGAAAAAACACGGTAACAGAAACAAAAAAGAGAAAAGCCGTAGGCTCTACAAGCACCTGGATGTGTGAGCTCGGCTGAACAGAGACGGCAGGCAGCTGC

GCTGTGCGGGAGGACACGAGCTCAAACCGCCACTGCTGCTGTCGCTGCCGTGCTGCTCTCCTGACCACTGCACTGTGGACTGGACCCTGCTCTCCTGGAG

AGCACAGTCGCACCAGAAGTCTTGACATCAAGACAGCCTTTCGGAAGCACCTGCTGTGGCCGTGGTAGTCATGGGGTGCCCCAGAAGTCTCATCCTGCAG

AAGGATGGTGGATATGTGTACAAGCATACAAATGCACATTGACTTTGAGGTTTTGGGAAGTTATTAAAATTAATTTTCCACTAGTTGATATTCTTATTGT

CTTAAGTAGGCAAGCTGCCATTTATACATTTAATGTTGACCCTCTAGGAAGGGTCTGGAGATGGCTCAGCAGTTAGGAGCATTGGTTGCCCTTTCAGAGG

ACCCCAGTGTGGTTCCTAGCACCTACATGGCAGCTCATAGCCATCGATAACTCCAGTGTTAGGGCATCTAATGACTTCTTCTGGCTCTGATGGGTACCAG

ACACACAAATGGTACGCAGACATTCATGCAGGCAAAACACCCATACACATAAACAGCACACATTCACTCAGGACTCCAGTCTCCCTGGGCTTCCTCGGCT

CCCTAGAGGTGACTGTGAGAGGTGGTTGAACGAGAATGGCCTGCAGAGGGCTTATGGATTTGCACACTTGGTTCCACCTCTGCCCCCTTTTAAACATAAA

GTTTTAAAAAAGGAAATACTAAAAATAAACTATGACTAGGACTTGAATTAATTTCCAGACACATATCTAACGTATCCCTGATATGGCAGAGGGCTAGCAG

GGGTGGTTTGGTAAGAGCTGGGCTGGACTGGTGAGACCATTGAGTGAAAGCTACTGTCACACAAACCTGCTGACCTTAGTCTGGTCTCTGGAGTCTACCA

AAGCGGGAGGACTCTGACCAGAGCATTCAAGCGCACACTAATTACAGAATGGGACACTCCAGAAAGCATCACCCCATGGGGGAAGCACTTGCTCAAACCC

ATAGAAACGAAAAAAGAGCCAGGTCAGCTGCTAGGCTTTATTTCAGACATGAATTTTTGATGTTATAGATGTTTGGGGGTAAAGTTCTACAGAAAAATAC

GCATTTCTGCAAACAGTTTTGTAAACTAGAATTCATTAAAGCCTCTGTCGCAACCATG
Translation
MGRRRAPGGGSLGRVLIRQQTQRSRSHRHTDSW - UNI7193 - LHTSELNDGYDWGRLNLQSVTEQSSLEDFLATAELAGTEFVAE EKLNIKFVPP

EARTGLLSFEESQRIKKLHEENRQFLCIPRR - UNI22830 - RPNWDRKTSPEELKQAEKDNFLKWRRQLVR - UNI22906 - RLEEEQKLILT

PFERNLDFWRQLWRVIERS SDIVVQIVDARNPLLFRCEDL ECYVKEIDAAKENVILINKADLLTAEQRFAWAVHFEKEGVKVIFWSALAETDHLNGDL

K EEVDSVAGDTNKTESESSSLDANEIPHRDLISLSEESASDSGDSKYEDCQEDEEEDWQTCSEEDSVPEEEEGCNADSETQNRKNAENQQVNNDSYLVS

KQELLELFKKLHTGKKVKDGQLTVGL VGYPNVGKSSTINTIMGNKKVSVSATPGHTKHFQ TLYVEPGLCLCDCPGLVMPSFVSTKAEMICNGILPIDQ

MRDHVPP IF FYVCQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGC - UNI27827 - CMRGFMTAHGQPDQPRSARYILKDYVG GKL

LYCHPPPGKDPVAFQHQHQQLLESKVKGGELRLQPGKGRKAKQIENVVDKTFFHQ - UNI16437 - ENVRALTKGVQAVMGYKPGHGLVTAAAASAE

NVPGKPWKKHGNRNKKEKSRRLYKHLDV
Transcript ENSMUST00000089772
Sequence
AGTGGTTTGTGCTGTTGATGCGTGGTTATGGGTCGGAGACGAGCGCCGGGTGGTGGGTCCCTGGGCCGAGTACTTATCCGGCAGCAGACTCAGCGAAGCC

GCAGCCACCGTCATACTGACTCCTGG - UNI7193 - CTGCATACAAGTGAACTCAATGATGGCTATGACTGGGGTCGTCTGAATCTTCAGTCTGTGA

CAGAGCAGAGCTCCCTGGAGGACTTTCTTGCAACTGCAGAACTTGCAGGGACCGAGTTTGTGGCTG AGAAGCTGAATATTAAGTTTGTACCCCCTGAGG

CTAGAACCGGACTGCTGTCTTTTGAGGAGAGCCAGAGAATTAAGAAACTCCACGAAGAAAACAGACAGTTCTTGTGTATACCAAGGAG - UNI22830 

- GCCAAATTGGGACAGAAAAACTAGCCCAGAAGAACTGAAACAAGCAGAGAAAGATAACTTCCTGAAATGGAGGCGCCAGCTTGTGCG - UNI22906

 - TGATATTGTGGTCCAGATCGTAGATGCTCGAAACCCGCTCCTGTTTAGATGTGAGGATTTG GAGTGTTACGTGAAAGAGATCGATGCTGCCAAGGA

GAACGTGATCCTGATAAACAAGGCAGACTTGCTGACTGCTGAGCAGCGGTTTGCCTGGGCTGTGCACTTTGAAAAGGAAGGGGTAAAGGTTATCTTCTGG

TCAGCTTTGGCAGAAACTGATCACCTAAATGGTGACTTGAAG GAGGAAGTAGACAGTGTTGCTGGAGACACCAACAAAACAGAGTCTGAAAGCTCCAGT

TTGGATGCGAATGAAATCCCACACAGAGACTTGATCTCGCTTAGTGAGGAGTCCGCAAGTGACAGTGGTGACAGCAAATATGAGGACTGTCAGGAGGACG

AAGAGGAAGATTGGCAGACGTGTTCAGAAGAAGACAGCGTCCCTGAGGAGGAGGAGGGCTGTAATGCGGATTCTGAGACTCAGAACAGAAAAAACGCAGA

AAATCAACAAGTGAACAATGATAGCTACCTGGTGTCGAAACAGGAATTACTGGAACTCTTTAAGAAACTCCACACTGGAAAGAAAGTGAAAGATGGACAG

CTAACTGTTGGGCTG GTGGGCTACCCTAATGTTGGTAAGAGCTCAACCATCAACACCATCATGGGCAACAAGAAAGTATCGGTGTCTGCCACGCCAGGC

CACACCAAGCATTTCCAG ACCCTGTACGTGGAGCCTGGCCTCTGCCTGTGTGACTGCCCGGGCCTGGTGATGCCATCTTTCGTGTCCACCAAAGCAGAG

ATGATTTGCAATGGGATCCTCCCTATCGACCAGATGAGAGACCACGTTCCACCCGTATCACTA GTTTGCCAGAATATCCCACGGCGAGTTTTGGAAGTG

ACATATGGTATTAACATTATAAAGCCTAGAGAAGATGAAGACCCCTACCGACCTCCAACCTCAGAAGAACTGTTGACGGCTTATGGAT - UNI27827 

- GCATGAGAGGATTCATGACAGCACATGGGCAGCCAGACCAGCCTCGATCTGCACGGTACATCCTAAAGGACTATGTTGGA GGTAAACTACTGTATTG

CCACCCTCCTCCTGGAAAAGACCCTGTGGCGTTCCAGCACCAACACCAGCAGCTCCTAGAGAGCAAAGTAAAAGGTGGAGAACTGAGACTTCAGCCGGGC

AAAGGCCGAAAAGCCAAACAGATCGAAAATGTAGTCGACAAAACTTTTTTCCATCAG - UNI16437 - GAGAACGTCAGAGCACTGACCAAAGGTGT

CCAGGCTGTCATGGGTTACAAGCCCGGGCATGGCCTGGTGACTGCGGCTGCTGCGAGCGCTGAGAATGTACCTGGGAAGCCCTGGAAAAAACACGGTAAC

AGAAACAAAAAAGAGAAAAGCCGTAGGCTCTACAAGCACCTGGATGTGTGAGCTCGGCTGAACAGAGACGGCAGGCAGCTGCGCTGTGCGGGAGGACACG

AGCTCAAACCGCCACTGCTGCTGTCGCTGCCGTGCTGCTCTCCTGACCACTGCACTGTGGACTGGACCCTGCTCTCCTGGAGAGCACAGTCGCACCAGAA

GTCTTGACATCAAGACAGCCTTTCGGAAGCACCTGCTGTGGCCGTGGTAGTCATGGGGTGCCCCAGAAGTCTCATCCTGCAGAAGGATGGTGGATATGTG

TACAAGCATACAAATGCACATTGACTTTGAGGTTTTGGGAAGTTATTAAAATTAATTTTCC
Translation
MGRRRAPGGGSLGRVLIRQQTQRSRSHRHTDSW - UNI7193 - LHTSELNDGYDWGRLNLQSVTEQSSLEDFLATAELAGTEFVAE EKLNIKFVPP

EARTGLLSFEESQRIKKLHEENRQFLCIPRR - UNI22830 - RPNWDRKTSPEELKQAEKDNFLKWRRQLVR - UNI22906 - RDIVVQIVDAR

NPLLFRCEDL ECYVKEIDAAKENVILINKADLLTAEQRFAWAVHFEKEGVKVIFWSALAETDHLNGDLK EEVDSVAGDTNKTESESSSLDANEIPHRD

LISLSEESASDSGDSKYEDCQEDEEEDWQTCSEEDSVPEEEEGCNADSETQNRKNAENQQVNNDSYLVSKQELLELFKKLHTGKKVKDGQLTVGL VGYP

NVGKSSTINTIMGNKKVSVSATPGHTKHFQ TLYVEPGLCLCDCPGLVMPSFVSTKAEMICNGILPIDQMRDHVPPVSL VCQNIPRRVLEVTYGINIIK

PREDEDPYRPPTSEELLTAYGC - UNI27827 - CMRGFMTAHGQPDQPRSARYILKDYVG GKLLYCHPPPGKDPVAFQHQHQQLLESKVKGGELRL

QPGKGRKAKQIENVVDKTFFHQ - UNI16437 - ENVRALTKGVQAVMGYKPGHGLVTAAAASAENVPGKPWKKHGNRNKKEKSRRLYKHLDV
Transcript ENSMUST00000023190
Sequence
AGTGGTTTGTGCTGTTGATGCGTGGTTATGGGTCGGAGACGAGCGCCGGGTGGTGGGTCCCTGGGCCGAGTACTTATCCGGCAGCAGACTCAGCGAAGCC

GCAGCCACCGTCATACTGACTCCTGG - UNI7193 - CTGCATACAAGTGAACTCAATGATGGCTATGACTGGGGTCGTCTGAATCTTCAGTCTGTGA

CAGAGCAGAGCTCCCTGGAGGACTTTCTTGCAACTGCAGAACTTGCAGGGACCGAGTTTGTGGCTG AGAAGCTGAATATTAAGTTTGTACCCCCTGAGG

CTAGAACCGGACTGCTGTCTTTTGAGGAGAGCCAGAGAATTAAGAAACTCCACGAAGAAAACAGACAGTTCTTGTGTATACCAAGGAG - UNI22830 

- GCCAAATTGGGACAGAAAAACTAGCCCAGAAGAACTGAAACAAGCAGAGAAAGATAACTTCCTGAAATGGAGGCGCCAGCTTGTGCG - UNI22906

 - GCTAGAAGAGGAACAGAAGTTGATATTGACTCCCTTTGAACGGAACTTGGACTTCTGGCGCCAGCTCTGGAGGGTCATTGAGAGAAG TGATATTGT

GGTCCAGATCGTAGATGCTCGAAACCCGCTCCTGTTTAGATGTGAGGATTTG GAGTGTTACGTGAAAGAGATCGATGCTGCCAAGGAGAACGTGATCCT

GATAAACAAGGCAGACTTGCTGACTGCTGAGCAGCGGTTTGCCTGGGCTGTGCACTTTGAAAAGGAAGGGGTAAAGGTTATCTTCTGGTCAGCTTTGGCA

GAAACTGATCACCTAAATGGTGACTTGAAG GAGGAAGTAGACAGTGTTGCTGGAGACACCAACAAAACAGAGTCTGAAAGCTCCAGTTTGGATGCGAAT

GAAATCCCACACAGAGACTTGATCTCGCTTAGTGAGGAGTCCGCAAGTGACAGTGGTGACAGCAAATATGAGGACTGTCAGGAGGACGAAGAGGAAGATT

GGCAGACGTGTTCAGAAGAAGACAGCGTCCCTGAGGAGGAGGAGGGCTGTAATGCGGATTCTGAGACTCAGAACAGAAAAAACGCAGAAAATCAACAAGT

GAACAATGATAGCTACCTGGTGTCGAAACAGGAATTACTGGAACTCTTTAAGAAACTCCACACTGGAAAGAAAGTGAAAGATGGACAGCTAACTGTTGGG

CTG GTGGGCTACCCTAATGTTGGTAAGAGCTCAACCATCAACACCATCATGGGCAACAAGAAAGTATCGGTGTCTGCCACGCCAGGCCACACCAAGCAT

TTCCAG ACCCTGTACGTGGAGCCTGGCCTCTGCCTGTGTGACTGCCCGGGCCTGGTGATGCCATCTTTCGTGTCCACCAAAGCAGAGATGATTTGCAAT

GGGATCCTCCCTATCGACCAGATGAGAGACCACGTTCCACCCGTATCACTA GTTTGCCAGAATATCCCACGGCGAGTTTTGGAAGTGACATATGGTATT

AACATTATAAAGCCTAGAGAAGATGAAGACCCCTACCGACCTCCAACCTCAGAAGAACTGTTGACGGCTTATGGAT - UNI27827 - GCATGAGAGG

ATTCATGACAGCACATGGGCAGCCAGACCAGCCTCGATCTGCACGGTACATCCTAAAGGACTATGTTGGA GGTAAACTACTGTATTGCCACCCTCCTCC

TGGAAAAGACCCTGTGGCGTTCCAGCACCAACACCAGCAGCTCCTAGAGAGCAAAGTAAAAGGTGGAGAACTGAGACTTCAGCCGGGCAAAGGCCGAAAA

GCCAAACAGATCGAAAATGTAGTCGACAAAACTTTTTTCCATCAG - UNI16437 - GAGAACGTCAGAGCACTGACCAAAGGTGTCCAGGCTGTCAT

GGGTTACAAGCCCGGGCATGGCCTGGTGACTGCGGCTGCTGCGAGCGCTGAGAATGTACCTGGGAAGCCCTGGAAAAAACACGGTAACAGAAACAAAAAA

GAGAAAAGCCGTAGGCTCTACAAGCACCTGGATGTGTGAGCTCGGCTGAACAGAGACGGCAGGCAGCTGCGCTGTGCGGGAGGACACGAGCTCAAACCGC

CACTGCTGCTGTCGCTGCCGTGCTGCTCTCCTGACCACTGCACTGTGGACTGGACCCTGCTCTCCTGGAGAGCACAGTCGCACCAGAAGTCTTGACATCA

AGACAGCCTTTCGGAAGCACCTGCTGTGGCCGTGGTAGTCATGGGGTGCCCCAGAAGTCTCATCCTGCAGAAGGATGGTGGATATGTGTACAAGCATACA

AATGCACATTGACTTTGAGGTTTTGGGAAGTTATTAAAATTAATTTTCC
Translation
MGRRRAPGGGSLGRVLIRQQTQRSRSHRHTDSW - UNI7193 - LHTSELNDGYDWGRLNLQSVTEQSSLEDFLATAELAGTEFVAE EKLNIKFVPP

EARTGLLSFEESQRIKKLHEENRQFLCIPRR - UNI22830 - RPNWDRKTSPEELKQAEKDNFLKWRRQLVR - UNI22906 - RLEEEQKLILT

PFERNLDFWRQLWRVIERS SDIVVQIVDARNPLLFRCEDL ECYVKEIDAAKENVILINKADLLTAEQRFAWAVHFEKEGVKVIFWSALAETDHLNGDL

K EEVDSVAGDTNKTESESSSLDANEIPHRDLISLSEESASDSGDSKYEDCQEDEEEDWQTCSEEDSVPEEEEGCNADSETQNRKNAENQQVNNDSYLVS

KQELLELFKKLHTGKKVKDGQLTVGL VGYPNVGKSSTINTIMGNKKVSVSATPGHTKHFQ TLYVEPGLCLCDCPGLVMPSFVSTKAEMICNGILPIDQ

MRDHVPPVSL VCQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGC - UNI27827 - CMRGFMTAHGQPDQPRSARYILKDYVG GKLLY

CHPPPGKDPVAFQHQHQQLLESKVKGGELRLQPGKGRKAKQIENVVDKTFFHQ - UNI16437 - ENVRALTKGVQAVMGYKPGHGLVTAAAASAENV

PGKPWKKHGNRNKKEKSRRLYKHLDV

For any suggestions or comments, please send an email to unitrap@crg.es