Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022544 (5730409G15Rik)
Chromosomal location
Chr 16: 5244248 - 5256049 (-)
Description
RIKEN cDNA 5730409G15 gene Gene [Source:MGI Symbol;Acc:MGI:1917761]
RefSeq_dna
NM_027446 
RefSeq_peptide
NP_081722.1 
UniGene
Mm.45780 
MGI
MGI:1917761 
Uniprot/SWISSPROT
Q3UZW7 
Human Ortholog
ENSG00000160172 (AC092903.11-201)
Omim not available
UniTrap UNI19233
Vector Insertion
Chr 16: 5253181 - 5255933
Public Clones D185A10 (ggtc) IST14287F2 (tigm)
Private Clones OST399700 (lexicon) OST378927 (lexicon) OST323421 (lexicon) OST298212 (lexicon)
OST252373 (lexicon) OST246387 (lexicon) OST203822 (lexicon) OST181150 (lexicon)
OST148150 (lexicon) OST98952 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16762
Vector Insertion
Chr 16: 5250649 - 5253117
Public Clones E128E12 (ggtc) IST14907C7 (tigm)
Private Clones OST454778 (lexicon) OST288660 (lexicon) OST207043 (lexicon) OST166449 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25101
Vector Insertion
Chr 16: 5249542 - 5250567
Public Clones not available
Private Clones OST195145 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26862
Vector Insertion
Chr 16: 5248924 - 5249004
Public Clones not available
Private Clones OST90518 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064635
Sequence
AACCCTGGCCCTGCCCCGCGATGGCGCCTGAGGACCACGAGGGGGCCACGTCTCTGCTGCAGAGTTTCGAGCGCCGCTTCCTGGCGGCTCGCGCGCTGCC

CTCCTTTCCCTGGCAG - UNI19233 - AGCCTAGAAGAAAAACTAAAGGACCCCTCGGGTTCTGAGCTGTTGCTGGCTATTCTGCAGAGG - UNI1

6762 - ACTGTGAAGCACCCTGTGTGTGTGCAGCACGGACCTTCTGTGAAGTATGCCCGCTGCTTTCTCTCAAAGCTCATCAAAAAG - UNI25101 

- CATGAGGCTGTACCCACGGAGCCTTTGGATGCACTGTATGAGGCGTTGGCAGAGGTTCTGATGACCCAAGAGTCCACCCAGTGCCACCGGAGCTATTT

GCTG CCTTCAGGAAACTCAGTTACACTCTCTGAGAGCACTGCCATCGTGTCCCATGGCACCACAGGCTTGGTTACATGGGACGCTGCTCTCTACCTGGC

AGAATGGGCCATTGAGAACCCAGCAGCCTTCACTGACAG - UNI26862 - GACTATCCTGGAGCTAGGCAGTGGAGCTGGCCTTACAGGCCTGGCAA

TTTGCAAGGCATGCTGCCCCAGAGCATACATCTTCAGCGACTGTCATGCCCAAGTGCTTGAGCAGCTCCGTGGAAACGTTCTCCTCAACGGCTTCTCCTT

AGAGCCGCACACCCCCATTGACGCAGGCAGCTCGAAGGTGACAGTGGCTCAGCTGGACTGGGACGAGGTGACAGCCTCTCAGCTCTCTGCCTTCCAGGCA

GATGTTGTCATTGCAGCAG ATGTACTGTACTGCTGGGAGATGACACTGTCACTGGTCAGGGTCCTGAAGATGCTCGAGGACTGCCAGAGGAAGAGCGCT

CCTGATGTCTATGTAGCCTATACTATCCGCAGCCAGGACACAGGCAAGCTGTTCATCGAAGAGCTGG ACCGTGCTGGAATCTACTGGGAAGAGGTGCCC

CCTCACACTGGCAAACTGTTCCCTTACGAAGAGCATTCAGCCATCGTAATCCTGAAGCTGGTGCTGACCAGTCGCCATGGTGTTTGAAGGTGATTTGAAA

AATGAGATGACTAGCCGGGTATGGTGGCGCACGCCTTTAGTCCCAGCACTCGCGCAGAGGCAGGTGGATTTCTGAGTTCAAGGCCAGCCTGGTCTACAAA

GTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAAACCTGTCTCAAAAAACCAAAAAAAAAAAGGAAAGAAAAGGAAAGAAGAGAAAAGAAAAATGACTG

TCATGGGAAAGCGGAAAGCGGAAAGGCTTCTGTTGAGCAGGAATGTTAAATAACAGCACAAGTGTACAGTAAGCACAGGCTGAGTGCTGGTGCCTGTCCT

CAGCAGCTCATCTCGAGTGGACACAGGCTCAGAGCAAACACTTCCATTGTACAAATAAATATATACATTTATTAAGTATGACTGTCCTGTCAGACAGTTC

AGCCTTGCTCAGCCAAACCCAGTGAACACAGGCTATCCCAGAGCTCACAGCAGAACCAGAACGCAAGGGATGTGACAAGTCCAGAAACAAAAACCCAGGG

ACTGAGAAGTTGGCAGGGACACTGGAAGTAACAGAAGTGCTCAGAACAGAAGAGAGCTGCCAGATCAGTAGCCAGATCCTAGCTGTCGCCCACTGCTGTC

CTCAGGCTTATGACCACTAGGGGGCACTCAAAAGCCCCGGCAGGAAGGGTGGCCACAGGGTGGATGGGGCCTGGGGGTCATCTGTGAGTGAGCGAGCAGA

GGGAGCACAGTGTGCTGCCAGCTCTCATCCCAGCGTTGCTGCCCCGACTCCTGCAGTTTCTTCCGGAACTGGCTTAGCTTTCCAGCAGGGTCTGGGAACT

TTGAGAAAAGCATCTAGGGAAACAGGAAAACTGGAACTCAGCTCCCTGCACCAGGCCCCGGCCTCCTTGCTCGTGTCCAGTGGTGCCCCTCCGCTCACTC

GACACTTGATGGATTCATCTACTCACCCACAGCCCTGCCCTAGAGAATGGCTAGCCTCCACCTGCTATTCTCTCAGTTTCCCCTCCCATCCTCAACACAC

CCCTGCAGATGCAGTTAAGATGGAAGCCTTTAGTGTGTCTATCAGGGACGGGTTGGGTCCTGCCCACCTGCCTTTGTAAATAAAGTTTTATTGGAACTC
Translation
MAPEDHEGATSLLQSFERRFLAARALPSFPWQ - UNI19233 - SLEEKLKDPSGSELLLAILQR - UNI16762 - TVKHPVCVQHGPSVKYARC

FLSKLIKK - UNI25101 - HEAVPTEPLDALYEALAEVLMTQESTQCHRSYLL PSGNSVTLSESTAIVSHGTTGLVTWDAALYLAEWAIENPAAFT

DR - UNI26862 - RTILELGSGAGLTGLAICKACCPRAYIFSDCHAQVLEQLRGNVLLNGFSLEPHTPIDAGSSKVTVAQLDWDEVTASQLSAFQAD

VVIAAD DVLYCWEMTLSLVRVLKMLEDCQRKSAPDVYVAYTIRSQDTGKLFIEELD DRAGIYWEEVPPHTGKLFPYEEHSAIVILKLVLTSRHGV

For any suggestions or comments, please send an email to unitrap@crg.es