Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022565 (Plec1)
Chromosomal location
Chr 15: 76001406 - 76061808 (-)
Description
plectin 1 Gene [Source:MGI Symbol;Acc:MGI:1277961]
RefSeq_dna
NM_201387 NM_201388 NM_201392 NM_201394 NM_201393 NM_201389 NM_201385 
RefSeq_peptide
NP_958789.1 NP_958790.1 NP_958794.1 NP_958792.1 NP_958796.1 NP_958795.1 NP_958793.1 NP_958791.1 NP_958788.1 NP_958787.1 NP_035247.1 
UniGene
Mm.418021 Mm.234912 
MGI
MGI:1277961 
Uniprot/SWISSPROT
Q9QXS1 
Uniprot/SPTREMBL
Q6S390 Q05CR3 Q6S388 Q6S385 Q6S387 Q499F9 Q6S392 Q6S393 Q8C8S5 
Human Ortholog
ENSG00000178209 (PLEC1)
Omim 131950 - EPIDERMOLYSIS BULLOSA SIMPLEX, OGNA TYPE  226670 - EPIDERMOLYSIS BULLOSA SIMPLEX WITH MUSCULAR DYSTROPHY  
UniTrap UNI37901
Vector Insertion
Chr 15: 76036027 - 76038684
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2348
Vector Insertion
Chr 15: 76021017 - 76021278
Public Clones AD0632 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37505
Vector Insertion
Chr 15: 76018066 - 76018505
Public Clones PST17965-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6584
Vector Insertion
Chr 15: 76015920 - 76016038
Public Clones YHB437 (baygenomics) YHB438 (baygenomics) YHB416 (baygenomics) YHB439 (baygenomics)
YHB440 (baygenomics) YHB424 (baygenomics) YHB235 (baygenomics) YHB436 (baygenomics)
M043C07 (ggtc) M020A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI192
Vector Insertion
Chr 15: 76014536 - 76015740
Public Clones GC0596 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080857
Sequence
GGAGGAGAGATTCCTACCCGTTGCTTCTGGTGCTGGGAGCTACTGCCCTCTCCTGCCTAAAGGTGGGATAGGGACTATGACTTGGTCAACTTAGTTACTG

TAAGGGCACCCTCGTGGGACTGGGCAGAAGAGACTTCAGGTCCAAGGGCTCAGGGGACTTTGGATGTGGCTGGAGATCATTAGGGGATGGTG ATGAACG

AGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG GCTCAGAGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGG

CCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGC

CCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGAC

AATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGT

AGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCTTCAATGCTATCATCCACCGGCACAA GCCCATGCTCAT

AGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCA

GAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGA

GTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAG

CGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAAC

CGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTG

GAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGC

AAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCT

CAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCAC

AGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCC

CTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAA

CCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTT

CGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTAT

GCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAG

AAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATG

AAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTG

CAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAG

GCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCACCATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATG

CCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTG

CCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTC

CTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCA

GGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCT

CAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCA

CTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTAC

CAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCC

TGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - 

AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCAC

CCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 - ACTCAAGAC

CATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAA

GAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCA

CAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGG

CTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCT

GCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGA

GGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCAATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTA

CAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCG

CTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCG

GGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTG

GAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGC

TGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCG

TGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAG

AAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGA

AGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGC

CGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAG

ACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGC

GAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAA

GAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAG

CTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGA

CAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGC

TGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGG

CTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGG

AGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGC

ACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAG

GCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGC

AGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGC

GGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAG

CGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCAC

GGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGC

CTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGA

GCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAG

AGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGC

AGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTG

ACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGC

AGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCAT

CCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAG

GAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAG

CCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCA

GCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGC

ATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAAC

TTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCT

GGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGAC

CCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAG

GACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGG

CCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGC

GGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCC

ACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCC

AGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTA

CCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGC

CCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGG

AGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTT

CCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCAC

CGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACC

CCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGC

CAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTG

ACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCA

TCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAG

TGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGT

ACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGG

CCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCC

TGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAG

GGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATG

TTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCC

AGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAG

GAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGC

TCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCAT

CACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATC

CTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCT

GCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCT

GGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTC

CATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGG

TCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTA

CCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCAAGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACC

TACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACAC

AGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGA

GGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGATCATTATCATC

ATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCC

GGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCAC

AGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTA

TTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCG

AGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACGGAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGA

GCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTG

GCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCA

GCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCG

CAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACT

AAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGG

GCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGA

AGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTC

ATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCG

AGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATGAACGAGATCTTGACTGATCCCTCAGATGACACCAAGGG

TTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAG

GAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACG

AGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGT

CGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCACCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTAC

CGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCT

ACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCT

GGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATT

GACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAAGATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCT

TCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGA

GGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCC

CAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGG

AGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTC

ACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTAC

TCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCC

TTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCC

CAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCA

GGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCA

GCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTG

CTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATAT

TCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTG

GCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACCCCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAG

CCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCG

GGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCA

CTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGT

CCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCC

AGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAACCTT
Translation
   MRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRD

GRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEY

RELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEW

GKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQG

EQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEF

RAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMREL

EMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDL

LQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPP

NQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREY

GSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARL

SAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKA

SLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRR

QEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSEL

TTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHL

RQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEA

EAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERARE

EAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQG

EQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAA

RQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEE

EIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLR

ERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQA

QAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQ

VEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL

KAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQ

EKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEV

AKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKA

LPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGT

ALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVP

VDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIW

EIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNV

IAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLI

PREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVY

SELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSR

AQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEK

LLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQ

LLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEI

IEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLE

AQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQ

RGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNL

QKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISL

FQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKK

RERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAG

TLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPS

TGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKL

RDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSS

GYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000076355
Sequence
GGTGTATGAGGGGGTAGTGAAGGCCTGTAGGGACCTTCATGCCCAAGGCACTAGGCGCCAGACGGGCTGGCCCTGGGAAAGGCCACACTGTGGCTCTTTG

TCCAGGGTTAGGGGGCTAGGGACTGCCCAAGGGCGCTGTCTGGTTGCTCTGGAAACCTGATGGGGCCGCCCAGGGAGTGCTGCTGGGCTCTCTCAGTGCT

GAATCAGCAACTTCTCAGTGTTTCTGCAAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG GCTCAG

AGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGG

AGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCT

GACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACA

GCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCT

TCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGG

CAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGT

ACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGC

TGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCA

AGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCC

AGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGA

GTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCA

GTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTT

CAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCAC

TGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTG

CGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGG

GCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTG

CCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTG

TGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAA

AGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCC

TGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAA

TACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCAC

CATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCG

GGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GT

GACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCT

GTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTT

CACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCC

GAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAG

TGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCA

TCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTG

CGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGA

GAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCT

GCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGC

AGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGC

CAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTG

GCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGC

TACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTG

CGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCA

ATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGG

AGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCC

GCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAG

CTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGT

GGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCT

GCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGC

AGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCG

CAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGA

CTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAG

TGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGA

GGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTG

CGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGC

GGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCT

GGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAG

GCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGG

AAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCT

GGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATC

AGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCC

AGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCA

GAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCA

GAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGG

CGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGA

GGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCC

GCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGC

TGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAA

ACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCG

GAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGC

AGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCT

GCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAG

CTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGG

TGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGA

GAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAG

GCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGC

TGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCA

GGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGAC

CACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG 

ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCA

TCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGA

ACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCAT

CTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCT

TGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGA

GTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCAC

ACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAAC

TGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGT

GCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGC

TACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGA

TCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTT

GTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAG

ACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCG

TGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCA

GCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGC

CTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAG

TGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGC

CCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTG

ACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACT

CAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCAT

TGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGAT

GATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTAC

TGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGT

GGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACA

GGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTG

CCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGA

GGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGC

CGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCC

ATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAA

CACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGAC

CCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCA

AGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACT

CAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGT

GGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGG

CTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGT

GCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTG

CTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCC

TTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGAC

CGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACG

GAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTG

TGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGT

GCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTG

CTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTAC

AGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCAC

CAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTC

ATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTG

CCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCT

GGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATG

AACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCA

CTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGAT

TGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGT

GAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCA

CCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTT

CCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAG

ACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGC

GGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAA

GATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAG

GGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACG

AAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAA

GATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGC

CCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTG

GCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGA

GTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCT

TTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATG

TCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCA

CAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAA

GCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAG

CTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGA

GAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACC

CCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGAC

CCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAG

CCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACA

GAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCAT

GTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAA

TTCCAACCTT
Translation
   MRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRD

GRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEY

RELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEW

GKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQG

EQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEF

RAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMREL

EMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDL

LQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPP

NQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREY

GSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARL

SAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKA

SLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRR

QEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSEL

TTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHL

RQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEA

EAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERARE

EAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQG

EQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAA

RQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEE

EIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLR

ERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQA

QAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQ

VEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL

KAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQ

EKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEV

AKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKA

LPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGT

ALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVP

VDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIW

EIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNV

IAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLI

PREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVY

SELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSR

AQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEK

LLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQ

LLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEI

IEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLE

AQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQ

RGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNL

QKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISL

FQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKK

RERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAG

TLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPS

TGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKL

RDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSS

GYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000023226
Sequence
CACAAGAACTTCAGTCTGAGCTGAGCCTCTGCTGAGTTACAAGTTACTGTCCAGAGCGGCGGGCCGGCAGCCTCCAGCAGCCTGTGTACCACCGCACGCA

CGAGGCTGCCTAGACTAGACGGAGCCCAGCACCTGAGAACTGAGGGACAGGGTGACCAAGGGGCGGGGCAGCACCATGTCTCAGCACCGGCTCCGTGTGC

CCGAGCCGGAAGGCCTGGGTAGCAAGAGAACCAGCTCAGAGGACAACCTCTACCTGGCTGTGCTCAGAGCCTCCGAGGGCAAGAAAG ATGAACGAGACC

GTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG GCTCAGAGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACA

ACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGG

ACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCA

TCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGG

GCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCTTCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATA

TGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG 

ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAG

GGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAA

GTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTC

CAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAA

GGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCT

ACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCG

AGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGT

GAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTG

ACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGC

GTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGC

CAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAA

GCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGA

AGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGA

AAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGAC

ACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGA

GGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCACCATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG

 GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCAC

CCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCC

CAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAG

CTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTC

GGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACC

AGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCA

GTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGA

GACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGC

GCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACT

CTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCA

GCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCT

TGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGA

GGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTT

CTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGG

ATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGA

TTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCAATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGG

CTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACA

GCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAG

AGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGC

ACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAG

CACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAG

TACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCG

GCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCT

GAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGG

CAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGC

ACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCC

CGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCC

TGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGC

GGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAG

CAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAAC

TGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGA

GGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGAT

GCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCA

AAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGA

CATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTG

GAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGG

ACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGT

GCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGC

CTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTG

TGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGC

CGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAG

CAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGC

TGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCAC

ACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGC

AGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTC

GTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGC

AGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACG

AGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGT

TGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGC

TGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCG

ACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGC

GTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGG

CCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGA

GGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGG

AGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGG

AAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAA

GGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAG

CTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGT

ACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGG

AACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGT

GTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGG

CCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGT

GCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAAC

ACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGG

GTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCAT

CTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAA

ATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGG

TCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAA

TGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTG

CTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGC

TGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCT

CATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCC

TATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCA

CCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGT

CTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATC

AGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCA

TCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAG

CAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTG

GCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGG

CCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGA

GAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTC

AGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGC

GTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCAAGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCT

GCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTG

TATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGA

TGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGA

AATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATC

ATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCG

CGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCT

GGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTG

CATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACGGAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGA

TCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTA

CCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTAC

ACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGC

AGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAA

CCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATC

ATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCG

TTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTC

CCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAG

AGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATGAACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCT

TTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAA

GAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCC

TACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCA

AGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCACCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGC

TGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCC

ATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGA

AGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCC

CAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAAGATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGT

GGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGC

AGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAA

GCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAG

GGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCA

CTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTC

CTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCC

GCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGC

GGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCC

AGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTA

TACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAG

GGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGT

GGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCC

AGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACCCCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTC

CAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCT

GGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCC

AGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGC

CAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCA

GAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAACCTT
Translation
MSQHRLRVPEPEGLGSKRTSSEDNLYLAVLRASEGKKD DERDRVQKKTFTKWVNKHLIK AQRHISDLYEDLRDGHNLISLLEVLSGDSL PREKGRMR

FHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFN

AIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVL

LLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHV

AILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYR

R RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIE

RARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEK

KIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ

 DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQ

EAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSR

HYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAE

KVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK K

LRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQ

AVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTS

QYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSE

AEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAARE

KQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERE

LERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQ

LLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAE

AERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMAL

KVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQ

ESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQ

AQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEEL

FSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAE

LLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTL

VQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQ

LREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGR

DAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILL

EAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAY

KRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINS

EYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVW

LEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQG

LRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQA

RETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQ

LKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAE

KAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERC

VEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTE

IIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAAT

GFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLN

KDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLE

GTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMK

KGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKT

SSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSIT

EFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERF

PVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSA

YSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRR

YASGPSASLGGPESAVA
Transcript ENSMUST00000072692
Sequence
GCGGGGGCGAACGTGGAAGCCAGGGCCTTCAGCCTTCAACACAAGCACGGCTTTCGTGTCGTCTGCGAGCAGCCCAGGGCACTCGGGGCTCCTGGCAATG

GCAGGGACGTGGGCGGCGAAGGGAGTCTTCACTTCGCAGAGGGAGGTCCTGCTGGAGCGTCCCTGCTGGCTGGATGGGGGCTGCGAGCAGGTCCGCAGGG

GCTACCTCTACGGGCAACTCTGTTGTGTAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG GCTCAG

AGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGG

AGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCT

GACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACA

GCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCT

TCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGG

CAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGT

ACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGC

TGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCA

AGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCC

AGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGA

GTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCA

GTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTT

CAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCAC

TGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTG

CGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGG

GCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTG

CCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTG

TGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAA

AGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCC

TGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAA

TACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCAC

CATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCG

GGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GT

GACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCT

GTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTT

CACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCC

GAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAG

TGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCA

TCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTG

CGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGA

GAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCT

GCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGC

AGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGC

CAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTG

GCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGC

TACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTG

CGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCA

ATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGG

AGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCC

GCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAG

CTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGT

GGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCT

GCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGC

AGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCG

CAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGA

CTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAG

TGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGA

GGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTG

CGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGC

GGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCT

GGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAG

GCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGG

AAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCT

GGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATC

AGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCC

AGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCA

GAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCA

GAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGG

CGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGA

GGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCC

GCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGC

TGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAA

ACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCG

GAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGC

AGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCT

GCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAG

CTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGG

TGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGA

GAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAG

GCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGC

TGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCA

GGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGAC

CACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG 

ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCA

TCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGA

ACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCAT

CTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCT

TGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGA

GTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCAC

ACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAAC

TGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGT

GCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGC

TACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGA

TCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTT

GTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAG

ACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCG

TGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCA

GCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGC

CTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAG

TGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGC

CCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTG

ACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACT

CAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCAT

TGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGAT

GATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTAC

TGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGT

GGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACA

GGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTG

CCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGA

GGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGC

CGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCC

ATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAA

CACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGAC

CCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCA

AGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACT

CAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGT

GGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGG

CTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGT

GCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTG

CTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCC

TTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGAC

CGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACG

GAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTG

TGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGT

GCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTG

CTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTAC

AGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCAC

CAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTC

ATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTG

CCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCT

GGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATG

AACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCA

CTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGAT

TGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGT

GAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCA

CCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTT

CCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAG

ACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGC

GGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAA

GATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAG

GGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACG

AAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAA

GATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGC

CCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTG

GCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGA

GTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCT

TTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATG

TCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCA

CAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAA

GCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAG

CTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGA

GAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACC

CCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGAC

CCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAG

CCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACA

GAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCAT

GTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAA

TTCCAACCTT
Translation
MAGTWAAKGVFTSQREVLLERPCWLDGGCEQVRRGYLYGQLCCVD DERDRVQKKTFTKWVNKHLIK AQRHISDLYEDLRDGHNLISLLEVLSGDSL P

REKGRMRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSW

RDGRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQ

EYRELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEK

EWGKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHP

QGEQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIE

EFRAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMR

ELEMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLE

DLLQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVP

PPNQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAER

EYGSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVA

RLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEAT

KASLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAK

RRQEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYS

ELTTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQ

HLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKA

EAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERA

REEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETE

QGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEED

AARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQV

EEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARR

LRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEE

QAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQR

SQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEAT

RLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELA

TQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQD

EVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAAST

KALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSP

GTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHR

VPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVT

IWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGT

NVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKG

LIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEE

VYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKIL

SRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELH

EKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTY

LQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIII

EIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLL

LEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVA

YQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTK

NLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLI

SLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKE

KKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYR

AGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIID

PSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQ

KLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYS

SSGYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000054449
Sequence
CGGCTGGGTGCAGATGGTACAGTAGGGCTGTCTCTGAAGGCAGGGCAGCAGGAGCCAGAGTGGACTCTGGTTCCGGGGCACCCCCTTGGCTCACCCTCCA

TGTAGGGAGGTGCTGTCGGACTTCGCAGCAGCTGGTCCCTGGTGAGGACGGCTCTGCCCATTCTGTGCGGCAGCCATGGAGCCGTCGGGCAGCCTGTTTC

CCTCCCTGGTAGTCGTGGGTCATGTTGTCACTCTGGCTGCCGTATGGCACTGGCGTAAGGGGCATCGGCAGGCAAAGGATGAGCAAG ATGAACGAGACC

GTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG CACTGGAGGGCAGAG GCTCAGAGGCACATCAGTGACCTGTACGAAGAC

CTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAAT

GTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGC

CTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCA

CAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCTTCAATGCTATCATCCACCGGCACAA G

CCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGC

TCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTG

CACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTG

CTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGG

CAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACC

CACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGC

GCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAG

GCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGG

GCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGG

AGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGG

GTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTA

TAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAG

ACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGT

GGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAG

AACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCC

AGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAG

ATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCACCATCACCGTCACCAGGCTCGAGGATCT

GCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCC

ACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCA

GCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAAC

CAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCG

TGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAAC

CTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCA

GCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGC

AGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG -

 UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTC

ACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 

- ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTG

CCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGT

TGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGA

GCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTG

AGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG 

GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCAATGCAATCAAG GACTATGAGCTCCAG

CTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGAT

CTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCT

GAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCC

AGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCAT

CCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAG

GAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGG

CAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGC

CCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGG

CTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCT

TTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGC

TGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTG

GCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGC

GGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCT

GCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAG

GAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGT

CTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCA

GTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAG

GCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGG

CACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCG

ACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATT

CGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGG

AGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGT

TGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAG

AAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGG

CAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAA

ACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAG

GCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAG

AGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGA

GGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAAC

CGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCG

TGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGC

GGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAG

CAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCC

TCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCA

CCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCC

ATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATA

CTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGC

AGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAG

CATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAG

AAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCC

AGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAA

GGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGG

GAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGC

AGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGA

GGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAGGACCCCTATACAGGGGAACAG

ATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTG

TGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGG

CTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACA

GATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGG

GCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGT

GGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAG

CTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGG

CCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGA

GGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGC

CTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGG

CCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGT

GCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGC

ACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGG

CCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGAC

TGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATC

AAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGG

ACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCA

GGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCC

ACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGG

GCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAA

AAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTG

GACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCAAGGGCTTCTTTGACCCCAACACCCACG

AGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGT

AGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATG

TCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGA

TCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCT

GTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTAC

CTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGG

TGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCT

GGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACGGAACAGACCATCTCACTCTTCCAGGCC

ATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCC

CTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGA

TGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTC

CGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCG

AGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGC

TATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTG

ACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACT

CTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCAT

CATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATGAACGAGATCTTGACTGATCCCTCAGAT

GACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCC

TGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGAT

GTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCC

TCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCACCAAGAACCTCATTGACCGCTCAGCAC

TGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTC

ATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGAC

ACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCG

GGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAAGATCATGGTAGACCGTATCAATCTGGC

CCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAG

CGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATG

CCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCG

TAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCG

ACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTT

CTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCC

TGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGG

TGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACA

GGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAG

CTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCT

GGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAAT

GTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAG

GCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACCCCATACTTATTCCCCTGAGACCTGAGC

CTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATT

CTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGC

TGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCC

TTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAG

GTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAACCTT
Translation
MEPSGSLFPSLVVVGHVVTLAAVWHWRKGHRQAKDEQD DERDRVQKKTFTKWVNKHLIK HWRAE AQRHISDLYEDLRDGHNLISLLEVLSGDSL PR

EKGRMRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWR

DGRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQE

YRELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKE

WGKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQ

GEQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEE

FRAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRE

LEMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLED

LLQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPP

PNQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAERE

YGSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVAR

LSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATK

ASLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKR

RQEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSE

LTTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQH

LRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAE

AEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAR

EEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQ

GEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDA

ARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVE

EEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRL

RERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQ

AQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRS

QVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATR

LKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELAT

QEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDE

VAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTK

ALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPG

TALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRV

PVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTI

WEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTN

VIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGL

IPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEV

YSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILS

RAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHE

KLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYL

QLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIE

IIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLL

EAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAY

QRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKN

LQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLIS

LFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEK

KRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRA

GTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDP

STGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQK

LRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSS

SGYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000076442
Sequence
ACAGAGCAAGGCTCTGGAGCCGCACTGCCCCTGAGCCTGCGCCCTTGTGCTTAGAACCGGAGCCTGCCTGCCTGTTTGCCAGTGGCCCCTGCTGCATCTT

GTGCCAAAGGAGCTTCATCAGCCTCCTGGCTGTGCCCCACCTGCTGTCCTCACCCTGTGCTGACCGGCAGGCTTCCAGCAGCCATGGTGGCTGGCATGCT

CATGCCGCTGGACCGGCTACGGGCCATCTATGAGGTGCTCTTCCGTGAGGGGGTGATGGTTGCCAAGAAGGACCGGCGACCCCGCAGCCTGCATCCCCAT

GTGCCCGGCGTCACCAATCTACAGGTCATGCGTGCCATGGCTTCACTGAAAGCTCGGGGCCTGGTGCGGGAGACCTTTGCCTGGTGCCACTTCTACTGGT

ACCTGACCAACGAGGGCATTGACCACCTACGCCAGTACTTACACCTGCCACCGGAGATTGTACCTGCCTCTCTGCAGCGTGTGCGCCGCCCTGTCGCCAT

GGTGATACCTGCACGTCGTCGCTCCCCCCATGTGCAGACCATGCAAGGTCCCCTAGGCTGCCCACCAAAGAGGGGGCCTCTGCCAGCTGAGGACCCTGCC

CGTGAGGAGCGGCAGGTCTATCGCAGGAAGGAGCGTGAGGAGGGGGCACCTGAAACCCCTGTGGTGTCTGCCACCACCGTGGGGACCCTGGCCAGACCAG

GTCCGGAGCCTGCCCCAGCCACAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG GCTCAGAGGCAC

ATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGGAGGATG

CGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCTGACGGC

AACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACAGCAAAG

GAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCTTCAATG

CTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGGCAGAGC

GGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGTACGATG

CTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAAT

GGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGA

CAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCCAGCTCA

AGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGA

GAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCAGTCG G

ATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTTCAATGA

TGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCACTGAGTA

CAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTGCGCTAC

CTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCC

ACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACC

GGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGG

CAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAAAGAAAG

TTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCCTGCCCG

GCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAATACAGC

CTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCACCATCAC

CGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAA

GGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GTGACTGT

GCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGC

TTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTTCACGTG

GACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCCGAGGAG

CAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAG

AGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGG

AGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTGCGCCCA

GCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGT

TCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATC

TACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGA

AGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTAT

TCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGA

ACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTAT

CGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAG

AACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCAATGCAA

TCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCG

TCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCCGCATGG

AAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGG

CACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGC

ACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAA

CGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTC

TGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACG

GCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAG

GCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGC

TGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGA

GCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTG

CGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCA

AGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGC

GGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAGGCCACC

GCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGT

CTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGA

GGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAG

GCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGC

GGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGG

CTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTG

GAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAG

AGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGT

CGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAG

AAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGCTGGATC

GGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGT

GGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAG

GAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGCAGACAC

TCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCG

ACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAG

GCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCG

AGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGAT

GCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGG

CGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGA

TGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGA

AGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGACCACGAT

GCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAG

ACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGC

AGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGA

AAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAG

CAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTC

ACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGAGTACAC

CTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCACACCACG

GTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAACTGAGTG

TCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAA

TCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAG

GACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCA

CCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTTGTCTGA

CCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGC

CTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTG

CACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCAGCAGTT

CCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGT

GCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCG

AGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAA

GAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTGACTGTG

GACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACTCAGGAC

AGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGA

CCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGATGATGCC

AGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTACTGCCAC

TCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAG

CTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAG

GTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTG

TGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGG

CTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGC

CTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCCATGAGG

CTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAACACCAT

CTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGACCCGGTG

CACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCAAGGGCT

TCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGG

GGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGTGGTGGC

AGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGA

GGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGTGCGCCG

CCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAG

ATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCCTTAAGA

AGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGA

TGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACGGAACAG

ACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTGTGGACC

CCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAG

CTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCT

GATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTACAGCTAC

AAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCACCAAGGA

ACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTCATTGAC

CCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCA

CTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCTGGAGGC

TCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATGAACGAG

ATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCACTGACC

CCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGA

CCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGG

GAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCACCAAGA

ACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTC

CCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAGACTGGC

CCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGCGGCTGC

TGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAAGATCAT

GGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGG

CTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACGAAGCTC

TGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAAGATCTC

CTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGCCCGTAC

AGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTG

GCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGC

AGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTT

TTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATGTCCAGA

CAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCACAGCCA

GGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAAGCCAAC

CCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTT

CTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGAGAAGCC

CCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACCCCATAC

TTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGACCCAGAC

CCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTG

GAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACAGAAGCA

TTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCA

CTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAA

CCTT
Translation
MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLKARGLVRETFAWCHFYWYLTNEGIDHLRQYLHLPPEIVPASLQRV

RRPVAMVIPARRRSPHVQTMQGPLGCPPKRGPLPAEDPAREERQVYRRKEREEGAPETPVVSATTVGTLARPGPEPAPATD DERDRVQKKTFTKWVNKH

LIK AQRHISDLYEDLRDGHNLISLLEVLSGDSL PREKGRMRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQV

SGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPD

EKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQS

LE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASG

KVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLA

WVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKE

LMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ

 FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVH

KGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPE

EQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARE

CAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTIS

LVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAV

LAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITY

KAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAE

LEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEA

QKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAE

KTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQR

ELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQ

RLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALH

KADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAE

ERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAAR

RAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQE

LTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAA

QEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKL

RMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQ

ETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKL

LAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQRED

VYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQIS

LFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDK

AAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELL

DSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLV

GPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQ

EPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKI

VITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATL

LLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDV

AYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSL

WEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLY

GTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMK

KELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRG

LRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTV

EEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDT

KGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSD

GVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTE

TLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRF

LEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTA

GSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000073418
Sequence
ACAGAGCAAGGCTCTGGAGCCGCACTGCCCCTGAGCCTGCGCCCTTGTGCTTAGAACCGGAGCCTGCCTGCCTGTTTGCCAGTGGCCCCTGCTGCATCTT

GTGCCAAAGGAGCTTCATCAGCCTCCTGGCTGTGCCCCACCTGCTGTCCTCACCCTGTGCTGACCGGCAGGCTTCCAGCAGCCATGGTGGCTGGCATGCT

CATGCCGCTGGACCGGCTACGGGCCATCTATGAGGTGCTCTTCCGTGAGGGGGTGATGGTTGCCAAGAAGGACCGGCGACCCCGCAGCCTGCATCCCCAT

GTGCCCGGCGTCACCAATCTACAGGTCATGCGTGCCATGGCTTCACTGAAAGCTCGGGGCCTGGTGCGGGAGACCTTTGCCTGGTGCCACTTCTACTGGT

ACCTGACCAACGAGGGCATTGACCACCTACGCCAGTACTTACACCTGCCACCGGAGATTGTACCTGCCTCTCTGCAGCGTGTGCGCCGCCCTGTCGCCAT

GGTGATACCTGCACGTCGTCGCTCCCCCCATGTGCAGACCATGCAAGGTCCCCTAGGCTGCCCACCAAAGAGGGGGCCTCTGCCAGCTGAGGACCCTGCC

CGTGAGGAGCGGCAGGTCTATCGCAGGAAGGAGCGTGAGGAGGGGGCACCTGAAACCCCTGTGGTGTCTGCCACCACCGTGGGGACCCTGGCCAGACCAG

GTCCGGAGCCTGCCCCAGCCACAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG CACTGGAGGGCA

GAG GCTCAGAGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCG

CGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGA

TGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGA

GGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGAT

GGCCGTCTCTTCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCA

TTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTT

TCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTG

TTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTT

TTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTA

CAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAAC

TGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACG

CCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCC

GGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAG

CCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGA

CTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAG

GCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCC

ACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTG

CACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGG

CAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGG

AAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACT

TGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCT

GTGACCGCACCATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCC

TGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCA

GGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGC

TGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTG

GCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCAC

ACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAG

GACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGT

CAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCG

CACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTG

CTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCG

AAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACC

CATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAG

GCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAG

TTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCG

CCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAAC

TGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAG

CAGTACATCAATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAG

TCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAG

ACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAG

CGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGG

AGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCA

GGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAG

GGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATG

AGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGA

TGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGC

AGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGC

TGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAA

TGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAA

GCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCAC

AGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCT

ACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCG

CGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGC

TGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCT

GGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGAC

GAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGC

TGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGC

GGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAG

CGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGG

TGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGC

CCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAG

CAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGC

AGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCG

CAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAG

TTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGG

ATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGA

GCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAG

ATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGG

CCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGC

CCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGG

CAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCT

TCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACA

GCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAG

TCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGC

GAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGC

AGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGA

ACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCAC

CGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGG

CTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGC

ACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACC

AATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGC

TGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGC

CGTCACCGGCTACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTG

GAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGA

ACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGA

GGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAA

AAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGG

ACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTG

CTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCT

GTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCA

TCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAG

CGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGG

GATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCA

CTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTC

ACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGC

TTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTG

AGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCA

GTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGT

GGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAG

AGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGA

GGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGT

CTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCT

ACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGG

CATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGT

GATGACACCAAGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCC

TCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGA

CATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCT

GACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCT

ATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCT

CCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATC

TACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGG

AGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGA

CCCCTACACGGAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACA

GGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGC

CCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGAT

GCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCC

ACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTG

TTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCAC

CGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCA

GCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCA

TCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGA

TGAGGAGATGAACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAG

CGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCC

GCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGA

GCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGAC

GACGCCATCACCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATG

CCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCC

GACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATC

ACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCC

TGGTGGACAAGATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGC

CCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTG

TCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGA

CCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGG

CTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTT

GATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTG

GGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTT

TTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATAT

GTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTG

CCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCC

AGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGT

CCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAG

CCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTA

GCTCAACACCCCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGG

CCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGG

ACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATC

TATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTG

AGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCA

ATAAAAGCAATTCCAACCTT
Translation
MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLKARGLVRETFAWCHFYWYLTNEGIDHLRQYLHLPPEIVPASLQRV

RRPVAMVIPARRRSPHVQTMQGPLGCPPKRGPLPAEDPAREERQVYRRKEREEGAPETPVVSATTVGTLARPGPEPAPATD DERDRVQKKTFTKWVNKH

LIK HWRAE AQRHISDLYEDLRDGHNLISLLEVLSGDSL PREKGRMRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ 

ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DV

DVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRS

KVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DI

RLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRY

LQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFV

AAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKE

NTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQV

E VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT F

RTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLD

KDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - 

KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLL

ERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYE

LQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQ

AKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRAR

AEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSK

RASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEE

QAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRST

SEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLE

EQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQ

RRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRS

EAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQK

AQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAA

RLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAE

AERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQ

QEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQR

QQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAE

LTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPY

TGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRL

LPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALV

PAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEA

VRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVY

HDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTV

EKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLR

PSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSH

RLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHG

GSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMES

AWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTIS

LFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDAR

KLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIK

GLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILT

DPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEI

TISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVA

GILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYY

EAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVS

GSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA
Transcript ENSMUST00000071869
Sequence
ATTGATCAGCAGAAGCCCCGCCTCTGGCTAGCAAGCCCTGCCCCACACCTCCCAGCTCCTCCCTCAGGCTGCAGTGCTGGCCTTGGGCAGTGCGGTGCTG

TGCAGTCCTGGACACAGTGGCTGCAGCACACCGTCCTCAGCCCCCAAGTGAAGACATGGACCCCTCAAGAGCCATCCAGCACGAGATCAGCTCCCTCAAA

G ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG CACTGGAGGGCAGAG GCTCAGAGGCACATCAGTG

ACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCGCGAGAAAGGGAGGATGCGCTTCC

ACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGATGACATTGCTGACGGCAACCCCA

AGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGAGGACATGACAGCAAAGGAGAAGC

TGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGATGGCCGTCTCTTCAATGCTATCAT

CCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCATTCTCGGTGGCAGAGCGGGACCT

GGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTTTCATCCCTGTACGATGCTATGCC

CCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAATGGATCCG

GCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGACAGAACT

TCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTACAAGCGGGCCAGCTCAAGATTCC

CCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGAGAG GCT

GGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACGCCCTACTGCAGTCG GATATTCG

GCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCCGGCTGTTGTTCAATGATGTGCAG

ACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAGCCATCCGCACTGAGTACAACCTC

CGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGACTCCACACTGCGCTACCTGCAAG

ACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCCACCGAGG

CATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACCGGGACTG

CCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGGCAGCTAC

CAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGGCAGCCAAGAAAGAAAGTTACTCG

 GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGGAAGACCATCCTGCCCGGCCCACG

GTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACTTGAAAGAGAATACAGCCTACTTC

CAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCTGTGACCGCACCATCACCGTCACC

AGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAAGGCTATT

GTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCAGGTGGAG GTGACTGTGCACAAG

GGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGCTTTCTTG

TGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTGGCACCAGCTTCACGTGGACATGA

AGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCACACTGAAGCCCGAGGAGCAGCGAC

AAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAGAGCGCGA

GTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGGAGCTCAA

GGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCGCACGGGAGTGCGCCCAGCGCATC

GCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGTTCTAGCC

TTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATCTACCTGG

AGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGAAGGAGGC

CCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTATTCAACAC

CCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGAACGTGTC

ACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTATCGTGAGA

GCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAGAACAGCT

GCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAGCAGTACATCAATGCAATCAAG G

ACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCGTCATCCA

GGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAGACCCTTCGCCGCATGGAAGAGGA

GGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGGCACACGC

CCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGCACAGCAG

CAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAACGCAGCC

GGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTCTGCGCGC

TCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACGGCAGGCA

GAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAGGCCGAGG

AGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGCTGCAGAG

CAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGAGCGACGG

GCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTGCGGCTGC

AGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCAAGGCGGA

GGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGCGGAGCAA

GAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCTACAGCACGAGGCCACCGCAGCCA

CGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGTCTCGCTC

TACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGAGGAGGCC

AAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAGGCCACAC

GGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGCGGCGTCT

GGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGGCTTGGTG

GAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTGGAGCTGG

AGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAGAGGAGGA

GCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGTCGAGCGA

CTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAGAAACGGC

TGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAGCAGAACATGCTGGATCGGCTGCG

GAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGTGGAAGAG

GCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAGGAGGCGG

CGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAGTTTGCAGAGCAGACACTCCGGCA

GAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCGACTAAAG

GCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAGGCTCGCA

TTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCGAGGAAGC

GGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGATGCTGAAG

GAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGGCGGCTGC

AGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGATGAGCGC

GGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGAAGAGATC

GGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACAGCAGAGTGACCACGATGCCGAGC

GTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAGACTGTGC

AGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGCAGGAGAA

GGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGAAAAGCAG

GAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAGCAGCAGC

GGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTCACTCTGA

GATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGGCTGAACCCGAGTACACCTTTGAG

GGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGCACAGGGTCACACCACGGTGGCTG

AGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACCAATGAGAAACTGAGTGTCTACAC

AGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAATCGGCGG

CTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAGGACCCCT

ATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCACCGGTGG

CATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGAACCGCATCTTGTCTGACCCAAGC

GATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCC

TCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTGCACCGTT

TGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGGACCTGCTGCAGCAGTTCCGCACG

GGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGTGCCCTCG

TGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCGAGGCGGA

CAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAAGAAAGAC

TTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAGCGCCAGGCTGACTGTGGACGAGG

CGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGGGATCCCTACTCAGGACAGAGTGT

CTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGC

AAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTCACCCAGAGATGATGCCAGAGTCT

ACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGCTTGAGCCTACTGCCACTCTCAGA

GAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAGCTTTAAG

GGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAGGTCACCG

TGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTGTGCCGGC

CAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGGCTCCGTG

CGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCA

GACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGTCTGTATGTCCATGAGGCTGTCAA

GGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCTACTCGGGCAACACCATCTCGCTG

TTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGGCATCATCGACCCGGTGCACAGCC

ACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGTGATGACACCAAGGGCTTCTTTGA

CCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGGGGCAGAG

AAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGACATCCCGGGTGGTGGCAGCCACG

GTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGAGGGTAAC

CAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCTATGACTACGTGCGCCGCCGCCTC

ACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAGATGGAAT

CTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATCTACCAGGCCCTTAAGAAGGGGTT

GCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGATGAGGCT

GTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGACCCCTACACGGAACAGACCATCT

CACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCT

GGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAGCTACGTG

GACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCTGATGCCC

GCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCCACAGCGCTACAGCTACAAGAAGG

CCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTGTTGATGCCACCAAGGAACGGCTC

TCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCACCGGCTATGTCATTGACCCCATCA

AGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCACTGGCTA

CAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCATCCGTCTGCTGGAGGCTCAGATC

GCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGATGAGGAGATGAACGAGATCTTGA

CTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAGCGCTGCATCACTGACCCCCAGAC

GGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGACCCAGAG

ACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGGGAAGAGA

TCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGACGACGCCATCACCAAGAACCTCAT

TGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTCCCGCTCC

TCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCCGACTGAGGAGACTGGCCCCGTGG

CCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATCACCGGCCAGCGGCTGCTGGAGGC

CCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCCTGGTGGACAAGATCATGGTAGAC

CGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGGCTGTACT

ATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTGTCTCTCGACGAAGCTCTGCAACG

TGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGACCAAGCTCAAGATCTCCTACAAG

GACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGGCTACTACAGCCCGTACAGCGTCA

GTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTGGCTTCTC

CATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGCAGTGGCC

TGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTTTTCCTTT

TTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATATGTATGCGATGTCCAGACAGCCTG

TGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTGCCACTCACCACAGCCAGGTGCCT

TGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCCAGACCTCTAAGCCAACCCCACTG

GATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTTCTCCCCA

GTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAGCCTACCCAGAGAAGCCCCTTCCC

CATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTAGCTCAACACCCCATACTTATTCC

CCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGGCCCTAAAGACCCAGACCCAGGGT

AGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTGGAACCCC

TCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATCTATGCTAACAGAAGCATTTGGCC

AGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCACTAACCT

TGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAACCTT
Translation
MDPSRAIQHEISSLKD DERDRVQKKTFTKWVNKHLIK HWRAE AQRHISDLYEDLRDGHNLISLLEVLSGDSL PREKGRMRFHKLQNVQIALDYLRH

RQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHK KPMLIDMN

KVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVLLLLQWIRHHTAAFEER

KFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFER 

RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRR RVYRLHERLVAIRT

EYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDE SQLSPATRG

AYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEKKIKEIQNTGDRLLRED

HPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ DEKEQLNEYKGHLSG

LAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVAR RLEAQHQALV

TLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQG GEQ

EESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLR

SELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK KLRAQAEAQQPVFNTLR

DELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQ

EK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTSQYIKFISETLRRMEEE

E RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERS

RMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAE

EAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRL

QAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAA

TQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEAT

RLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELEL

ELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKR

LQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEA

ARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKAR

IEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRL

QEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAE

RLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEK

QELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTF

EGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNR

RLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDP

SDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFR

TGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKK

DLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDP

SKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSF

KGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEVGS

VRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTIS

LFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGA

EKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRR

LTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDE

AVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSY

VDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKER

LSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQ

IATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDP

ETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSR

SSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMV

DRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISY

KDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAV

A
Transcript ENSMUST00000074834
Sequence
GCGGCCGCCAGGGCTGGCCTTGCGCGGCGGCCCGTTGCGTTCTTCTCCCGCCAGCATGGCCCATCTGCTGACGTCTGGCCCACCACCCGACGAACAGGAT

TTCATCCAGGCCTACGAGGAGGTGCGGGAGAAGTACAAAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATC

AAG GCTCAGAGGCACATCAGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCCCG

CGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTTAGTGAACATCAGAAATGA

TGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCAGGTGAGCGGACAGTCGGA

GGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTCACCACCAGTTGGCGCGAT

GGCCGTCTCTTCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTGGAGAACCTAGACCAGGCA

TTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAGTCCATCATCACCTATGTT

TCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAGGAGTACCGGGAGCTTGTG

TTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG ATCCTATGGTGCCAGTTT

TTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - UNI2348 - GGGGCAGTA

CAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCCTGGAGCGGGAGAAGCAAC

TGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGCAGCTGAACCAGGCGGACG

CCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACAAGGCTGATGGTATGATCC

GGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTCTGCATGAGCGCCTGGTAG

CCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAGGCGCCCAGAGCTAGAGGA

CTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTGGACTTGCCCAGTGTGGAG

GCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG AGCCAGCTCTCCCCTGCC

ACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTCCGGTCCCTGGAGAGCTTG

CACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTGACCGCAATACCAACATGG

CAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAGGGGACAGGCTGCTGCGGG

AAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTTGCTGCATTGAAGCACACT

TGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGTTACGCAGGAAGTACAGCT

GTGACCGCACCATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACAAGGGGCACCTCTCAGGCC

TGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGCCGTGTGTGACTACAAGCA

GGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGGTTCCAGCAGCGAGGCCGC

TGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCAGGCCCTGGTCACACTGTG

GCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCCCTAGTCACG TTCCGCAC

ACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCCGGTGGCTTTGGGCCTGAG

GACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAGCAGGAGGAGTCCCGCTGT

CAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGCCACTGGATAAGGACCCCG

CACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGGGAGTTGCCCGGCTGTCTG

CTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGGCAAGCTGGAACAGGTCCG

AAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCTGAGGAGGTGCTTAAAACC

CATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAGCTGCGGGCCCAGGCCGAG

GCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATGGTGAGCGGGACGTAGAAG

TTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGAGCTCGAGCAGCTGGGCCG

CCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAGGCCGTGCCAATAGCCAAC

TGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAGTGCCAGAAGTTTGCTAAG

CAGTACATCAATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCCAAGAAGCCCAAGGTTCAG

TCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTATATCAAGTTCATCAGTGAG

ACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAGGCTGCGCTGGAGAAGCAG

CGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGGAGGTGGCGCGGCGCGAGG

AGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGATCCAGGCCAAGGCCCAGCA

GGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGGCAGCGTGGAGGGGCGGAG

GGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGCGAAGGCAGGTGCAGGATG

AGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAGGGCCCTGCAGGCCCTGGA

TGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCCCTGGAGACGGCACAGCGC

AGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGCATGTAACAGTGGCCCAGC

TGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCGCTGGCAGCTGAAGGCCAA

TGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAGGAAGAGGCCGAGCGGGAA

GCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGCTGGCGGAGGGCACCGCAC

AGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGAGGAAGAGCTGGCCCGGCT

ACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTACTTCTGGCCAGCAAGGCG

CGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGGCCGAGGAGGCTGCCCGGC

TGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCGGGTGCTTACTGAGAAGCT

GGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTGAGGCGCCTGGCAGAAGAC

GAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCAAGGCATCAGAGAGCGAGC

TGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAGCTTTGAGAAAGCCGCCGC

GGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAACTGGAGGCGGCCCGGCAG

CGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAGCCGCTCGGCAGCGCAAGG

TGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGCCAGGCAGCTGCAGCTGGC

CCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAGCAGACGCTTCAGCAAGAG

CAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGGCGGAGCGCGAGGCAGCGC

AGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGCGGCCGCAGAGAAGCTGCG

CAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAGATGGAGAAGCATAAAAAG

TTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACCACCAGAAGAGCATCCTGG

ATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGTCCGTGTGCAGATGGAGGA

GCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTGGAGGAGGAGGCCGAGAAG

ATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGGACCTGGCGCAGCAGCGGG

CCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCAGCAGCAGAAGGAGCTTGC

CCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGGACTCTGGAGGCCGAGCGG

CAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGGAGGAGGACGCCCAGCGCT

TCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGACGCTGGAGATCCAGCGACA

GCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCGAAGTTACTGCAGCTCAAG

TCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAGGACAGCCTGCTGCAGCGC

GAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGGAGCAGCAGCGGCAGCAGC

AGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGTGAGGCGCAAGCAAGAGGA

ACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAGCGCCTGGAGGAAGAGCAC

CGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCGATGGCCCGTCCGTGGAGG

CTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGAGGAACTGCAGCGTTTGGC

ACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGACTGTTACTGAAGCCCACC

AATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGGCAGCCTCGGGCTTCCTGC

TGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACTGCTGTCAGCTGAGCGTGC

CGTCACCGGCTACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGACCATGGCGTCCGCCTGCTG

GAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCTACTTCGATGAAGAGATGA

ACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCTGCTGGAGCGCTGTGTGGA

GGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAGGCCCGTGACGTCTTCGAA

AAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCACGGCGGAACAGCGACGGG

ACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGAGCGGAAGGGCCAGCTCTG

CTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTGCAGCGGGGTGAGCGTTCT

GTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAGCAGGGCAGAAGCTGAGCA

TCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATATCATCGACCCTGCCACCAG

CGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAGGCCGTGACAGGCTACAGG

GATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGCTGGATGCCCAGTTATCCA

CTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGACTAACAGGGCCCTGACGTC

ACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGGTCTGACCAGCTGACCGGC

TTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACACTGGAGCAGGCCAAGGTTG

AGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCGGCAGGAGTTGCTGCGGCA

GTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAGGAGAGACTGTCCTTTAGT

GGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATGGCAAGACATCAGTCAAAG

AGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGAGAAAGTAACCATCTATGA

GGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGACCCTGTGCGGAACCAACGT

CTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCACTGGCTACAAGGATCCCT

ACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGCCCAGGTCGCCACGGGTGG

CATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGTGTGCTGGCAGATCCAAGT

GATGACACCAAGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCC

TCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTTCGAGGAGACGCAGATTGA

CATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAGCGTGCCCGGCTCATGGCT

GACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCCAGCAGAACCTGGCCTCCT

ATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCGGGAAGGCACCAAGAACCT

CCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCCAGGCAGACGCTAACCATC

TACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGCTGGACCCAGTGAAGGGGG

AGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGCTGTAACTGGTTACCGAGA

CCCCTACACGGAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTGGATGCGCAGCTAGCCACA

GGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGCACGACCAGCTGTCGGAGC

CCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGATGACCCCAGCGGCCAGAT

GCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCTCAAGTCATGGACGAGGCC

ACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCTGCATTGCCGGAGTCTTTG

TTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCTGGAAGCACAGGCAGCCAC

CGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTCAAGGACAAGCTGCTGTCA

GCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGATCCTGAAGGACCATGGCA

TCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTATAAGCGCGGCCTCTTTGA

TGAGGAGATGAACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACTTACCTGCAGCTGATGGAG

CGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGTCCTCAGTGCGCAAGCGCC

GCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGACGTACCTGGAGTTGTCGGA

GCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGTCGCCAGTATGACATCGAC

GACGCCATCACCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTGACATGCTCTCAGGCAATG

CCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCTAGCCTCCTGGTCTGATCC

GACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGCAACCTGGTAGACAACATC

ACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTGAAGCTGTCAACAAGGGCC

TGGTGGACAAGATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAAGATGTCAGCTGCCCAGGC

CCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCTGACACGCCCGGCCGTGTG

TCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGTACCTCACGTGCCCCAAGA

CCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGCGGCACAGTCCAGCAAGGG

CTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGCTCCCGGCGTGGCAGCTTT

GATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAGGGCCTTCAGCCTCTCTTG

GGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGAGGCACTGGGGTCTTCTTT

TTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAGACTAACACATTAATATAT

GTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCCCTAAATCCTTTCTACCTG

CCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTCTATCTGGGAAAGGCCCCC

AGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGACAGCTCTTGAGGCCTCTGT

CCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAGGCCAACCATCTCTTCCAG

CCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCATTGGAGCTATGCTTTGTA

GCTCAACACCCCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTCTGTGTCCTTGTACCCAGG

CCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCCTGCTCCAGAGGCCCAGGG

ACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGAGACACCGGCTGGCCCATC

TATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCTGCCTCCACCCTCTGAGTG

AGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCCTGCGGTGTCCGCCCCTCA

ATAAAAGCAATTCCAACCTT
Translation
MAHLLTSGPPPDEQDFIQAYEEVREKYKD DERDRVQKKTFTKWVNKHLIK AQRHISDLYEDLRDGHNLISLLEVLSGDSL PREKGRMRFHKLQNVQI

ALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ ISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHK K

PMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVLLLLQWIRHH

TAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSKVIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQL

RSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRR RVYRLHE

RLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDE SQ

LSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEKKIKEIQNTG

DRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKENTAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ DEKEQLNE

YKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVAR RLE

AQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSL

EQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAEKVLALPEPS

PAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - KLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK KLRAQAEAQQ

PVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQA

AREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYELQLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTSQYIKFISET

LRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQ

VEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALD

ELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKAN

EALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARL

QHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKL

AAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAA

GKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLA

QEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLR

KEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEE

LGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELA

QEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQ

QSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQ

QQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVE

AEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFL

LDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEM

NRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRR

DLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLS

IYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLS

TGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKV

EVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVK

ELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDP

YSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLR

LLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLAS

YDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKG

ERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSE

PSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVF

VDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHG

IRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKR

RVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGN

AGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKG

LVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPK

TKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASL

GGPESAVA
Transcript ENSMUST00000089610
Sequence
GAGGCCATGTCAGGGGAGGATTCTGAGGTCCGGCCAGTGGCAGTGGCTGAAGGTAGTTCCAATGGAAGCAGTGGCTCACCCAGCCCCGGGGACACACTGC

CCTGGAACCTTGGGAAAACACAGAGAAGTCGGCGAAGTGGAGGTGGTTCTGTGGGCAATGGGAGCGTCTTGGACCCTGCAGAGCGGGCCGTCATCCGCAT

TGCAG ATGAACGAGACCGTGTGCAGAAGAAAACTTTCACCAAGTGGGTCAACAAACACCTTATCAAG CACTGGAGGGCAGAG GCTCAGAGGCACATC

AGTGACCTGTACGAAGACCTCCGTGATGGCCACAACCTCATCTCCCTGCTGGAAGTCCTCTCAGGAGACAGCCTG CCGAGGGAGCGGGACGTAATCAGG

AGTGTGCGCCTG CCCCGCGAGAAAGGGAGGATGCGCTTCCACAAGCTGCAGAATGTGCAGATTGCCCTGGACTATCTCCGACATCGCCAG GTGAAGTT

AGTGAACATCAGAAATGATGACATTGCTGACGGCAACCCCAAGCTGACCCTCGGCCTCATCTGGACAATCATCCTGCACTTCCAG ATCTCAGACATTCA

GGTGAGCGGACAGTCGGAGGACATGACAGCAAAGGAGAAGCTGCTGCTGTGGTCACAGCGTATGGTAGAGGGCTACCAAGGCCTGCGCTGTGACAACTTC

ACCACCAGTTGGCGCGATGGCCGTCTCTTCAATGCTATCATCCACCGGCACAA GCCCATGCTCATAGATATGAATAAAGTGTATCGACAGACCAACCTG

GAGAACCTAGACCAGGCATTCTCGGTGGCAGAGCGGGACCTGGGAGTTACACGGCTCCTGGACCCAGAAG ATGTGGACGTCCCTCAGCCTGATGAAAAG

TCCATCATCACCTATGTTTCATCCCTGTACGATGCTATGCCCCGCGTGCCTGGTGCACAGGACGGAGTGAGGGCCAAT GAGCTGCAGCTTCGTTGGCAG

GAGTACCGGGAGCTTGTGTTGCTGCTGCTGCAATGGATCCGGCACCACACCGCTGCTTTTGAGGAGCGCAAGTTCCCCTCCAGCTTTGAAGAGATTGAG 

ATCCTATGGTGCCAGTTTTTGAAGTTCAAGGAGACAGAACTTCCTGCCAAGGAGGCAGACAAAAACCGGTCCAAAGTTATCTACCAGTCTTTGGAG - U

NI2348 - GGGGCAGTACAAGCGGGCCAGCTCAAGATTCCCCCTGGCTACCACCCACTAGATGTGGAGAAGGAGTGGGGCAAGCTGCATGTGGCCATCC

TGGAGCGGGAGAAGCAACTGCGAAGCGAGTTTGAGAG GCTGGAGTGTCTTCAGCGCATTGTGAGCAAGCTACAGATGGAGGCTGGGCTGTGTGAGGAGC

AGCTGAACCAGGCGGACGCCCTACTGCAGTCG GATATTCGGCTGCTGGCCTCAGGCAAGGTGGCTCAGCGAGCTGGGGAAGTCGAGAGAGACCTGGACA

AGGCTGATGGTATGATCCGGCTGTTGTTCAATGATGTGCAGACCCTTAAAGATGGGCGGCATCCACAGGGTGAACAGATGTACCGGAG GGTGTATCGTC

TGCATGAGCGCCTGGTAGCCATCCGCACTGAGTACAACCTCCGGCTGAAGGCAGGAGTGGGTGCCCCTGTGACCCAGGTGACCCTGCAGAGTACACAGAG

GCGCCCAGAGCTAGAGGACTCCACACTGCGCTACCTGCAAGACCTGCTGGCCTGGGTAGAGGAGAACCAGCGTCGAATAGACAGTGCTGAGTGGGGCGTG

GACTTGCCCAGTGTGGAGGCCCAGCTGGGCAGCCACCGAGGCATGCATCAGTCTATAGAGGAATTTCGGGCCAAGATCGAGCGGGCTCGGAATGATGAG 

AGCCAGCTCTCCCCTGCCACCCGGGGTGCCTACCGGGACTGCCTAGGTCGCCTAGACCTGCAGTATGCAAAGCTGCTG AACTCCTCCAAGGCCCGCCTC

CGGTCCCTGGAGAGCTTGCACGGGTTTGTGGCGGCAGCTACCAAGGAGCTGATGTGGCTGAATGAGAAAGAAGAGGAGGAAGTGGGCTTTGATTGGAGTG

ACCGCAATACCAACATGGCAGCCAAGAAAGAAAGTTACTCG GCCCTGATGCGAGAACTGGAAATGAAGGAAAAGAAAATCAAGGAGATCCAGAACACAG

GGGACAGGCTGCTGCGGGAAGACCATCCTGCCCGGCCCACGGTGGAG TCCTTCCAGGCTGCCTTGCAGACACAGTGGAGCTGGATGCTGCAGCTGTGTT

GCTGCATTGAAGCACACTTGAAAGAGAATACAGCCTACTTCCAG TTCTTCTCAGATGTTCGGGAGGCGGAGGAACAGTTGCAGAAGCTACAGGAGACGT

TACGCAGGAAGTACAGCTGTGACCGCACCATCACCGTCACCAGGCTCGAGGATCTGCTGCAGGATGCCCAG GATGAGAAGGAACAACTGAATGAGTACA

AGGGGCACCTCTCAGGCCTGGCCAAGCGGGCCAAGGCTATTGTGCAGTTGAAGCCACGCAACCCTGCCCACCCGGTGCGGGGCCACGTGCCCCTGATAGC

CGTGTGTGACTACAAGCAGGTGGAG GTGACTGTGCACAAGGGTGACCAATGCCAGCTGGTGGGTCCTGCCCAGCCATCCCACTGGAAGGTGCTCAGTGG

TTCCAGCAGCGAGGCCGCTGTGCCTTCTGTGTGCTTTCTTGTGCCGCCGCCCAACCAGGAGGCCCAGGAAGCTGTCGCTAG ACTGGAGGCGCAGCATCA

GGCCCTGGTCACACTGTGGCACCAGCTTCACGTGGACATGAAGAGCCTTCTGGCGTGGCAGAGCCTCAGTCGGGACATACAGCTCATCCGGTCCTGGTCC

CTAGTCACG TTCCGCACACTGAAGCCCGAGGAGCAGCGACAAGCTCTGCGCAACCTGGAATTGCACTACCAGGCCTTCCTTCGAGACAGCCAGGATGCC

GGTGGCTTTGGGCCTGAGGACCGTCTAGTGGCAGAGCGCGAGTATGGATCTTGCAGCCGCCATTACCAGCAGTTACTACAAAGCCTGGAGCAGG GTGAG

CAGGAGGAGTCCCGCTGTCAGCGATGCATCTCGGAGCTCAAGGATATCCGGCTGCAGCTGGAGGCCTGTGAGACTCGGACTGTGCACCGTCTGCGGCTGC

CACTGGATAAGGACCCCGCACGGGAGTGCGCCCAGCGCATCGCTGAGCAACAG - UNI6584 - AAAGCGCAGGCTGAGGTGGAGGGGCTGGGCAAGG

GAGTTGCCCGGCTGTCTGCTGAGGCTGAGAAAGTTCTAGCCTTGCCAGAGCCGTCACCTGCTGCACCCACTCTGCGCTCGGAGTTGGAACTGACCCTGGG

CAAGCTGGAACAGGTCCGAAGCCTGTCTGCCATCTACCTGGAGAA - UNI192 - ACTCAAGACCATCAGCTTGGTGATTCGCAGTACCCAGGGGGCT

GAGGAGGTGCTTAAAACCCATGAGGAGCAGCTGAAGGAGGCCCAGGCTGTGCCTGCCACTCTCCAAGAGCTTGAAGCCACCAAGGCCTCACTAAAG AAG

CTGCGGGCCCAGGCCGAGGCACAGCAGCCAGTATTCAACACCCTAAGAGATGAGTTGCGGGGGGCACAGGAGGTTGGTGAGCGGCTACAGCAGCGGCATG

GTGAGCGGGACGTAGAAGTTGAGCGCTGGCGAGAACGTGTCACTCAGTTGCTGGAGCGCTGGCAGGCTGTTCTAGCCCAGACAGATGTGCGGCAGCGTGA

GCTCGAGCAGCTGGGCCGCCAGCTTCGCTACTATCGTGAGAGCGCGGATCCTCTGAGCGCCTGGCTGCAGGATGCCAAGAGGCGGCAAGAGCAGATCCAG

GCCGTGCCAATAGCCAACTGTCAGGCTGCGCGAGAACAGCTGCGCCAGGAGAAG GCCCTGCTGGAGGAGATTGAGCGTCATGGTGAGAAGGTTGAGGAG

TGCCAGAAGTTTGCTAAGCAGTACATCAATGCAATCAAG GACTATGAGCTCCAGCTGATCACGTACAAGGCTCAGCTTGAACCCGTGGCCTCCCCTGCC

AAGAAGCCCAAGGTTCAGTCTGGATCGGAGAGCGTCATCCAGGAG TACGTGGATCTGCGCACGCGCTACAGCGAGCTGACCACGCTCACGAGCCAGTAT

ATCAAGTTCATCAGTGAGACCCTTCGCCGCATGGAAGAGGAGGAG CGGCTGGCTGAGCAACAGCGGGCAGAGGAGCGGGAGCGACTGGCCGAGGTGGAG

GCTGCGCTGGAGAAGCAGCGGCAGCTAGCTGAGGCACACGCCCAGGCTAAGGCCCAGGCAGAGCTGGAAGCACAAGAACTGCAGCGGCGCATGCAGGAGG

AGGTGGCGCGGCGCGAGGAGGCAGCAGTGGACGCACAGCAGCAGAAGCGCAGCATCCAAGAGGAGCTGCAGCACCTGAGGCAGAGCTCGGAGGCAGAGAT

CCAGGCCAAGGCCCAGCAGGTGGAGGCTGCAGAACGCAGCCGGATGCGCATTGAGGAAGAGATCCGTGTAGTACGTCTGCAGCTGGAGACAACTGAGCGG

CAGCGTGGAGGGGCGGAGGGCGAGCTGCAGGCTCTGCGCGCTCGGGCTGAGGAGGCAGAAGCGCAGAAGCGGCAGGCTCAGGAGGAAGCTGAACGCTTGC

GAAGGCAGGTGCAGGATGAGAGCCAGCGCAAACGGCAGGCAGAGGCAGAGCTGGCCCTGCGTGTGAAGGCTGAAGCTGAGGCAGCGCGAGAGAAGCAGAG

GGCCCTGCAGGCCCTGGATGAGCTGAGACTGCAGGCCGAGGAGGCCGAGCGGCGGCTGCGCCAAGCCGAGGCAGAGCGGGCACGCCAAGTGCAGGTGGCC

CTGGAGACGGCACAGCGCAGTGCGGAAGTGGAGCTGCAGAGCAAGCGGGCATCCTTTGCAGAGAAGACCGCACAATTGGAGCGCACTCTGCAGGAGGAGC

ATGTAACAGTGGCCCAGCTGCGGGAGGAGGCCGAGCGACGGGCACAGCAGCAAGCTGAGGCTGAGCGAGCCCGGGAGGAAGCTGAGCGGGAGCTGGAGCG

CTGGCAGCTGAAGGCCAATGAAGCACTGCGGCTGCGGCTGCAGGCAGAAGAGGTGGCACAGCAGAAGAGCCTGGCACAGGCCGATGCCGAGAAGCAGAAG

GAAGAGGCCGAGCGGGAAGCGCGGCGGCGGGGCAAGGCGGAGGAGCAGGCTGTGCGGCAGCGGGAGCTGGCGGAGCAGGAGCTGGAGAAGCAGCGGCAGC

TGGCGGAGGGCACCGCACAGCAGCGCCTGGCTGCGGAGCAAGAGCTGATCCGCCTGCGGGCCGAGACAGAGCAAGGTGAGCAGCAGCGGCAGCTGCTGGA

GGAAGAGCTGGCCCGGCTACAGCACGAGGCCACCGCAGCCACGCAGAAGCGCCAGGAGCTGGAGGCTGAACTGGCTAAGGTCCGGGCAGAGATGGAGGTA

CTTCTGGCCAGCAAGGCGCGAGCCGAGGAAGAGTCTCGCTCTACCAGCGAAAAGTCTAAGCAGAGGCTAGAGGCTGAGGCAGGCCGCTTTCGGGAACTGG

CCGAGGAGGCTGCCCGGCTGCGTGCTCTGGCGGAGGAGGCCAAGAGGCAGAGGCAGTTGGCAGAGGAGGATGCCGCCCGCCAGCGGGCCGAGGCAGAGCG

GGTGCTTACTGAGAAGCTGGCTGCCATCAGTGAGGCCACACGGCTCAAGACGGAGGCAGAGATTGCACTCAAAGAGAAGGAGGCCGAGAATGAGCGCCTG

AGGCGCCTGGCAGAAGACGAGGCCTTCCAGCGGCGGCGTCTGGAGGAGCAGGCGGCACTGCACAAGGCTGACATCGAGGAGCGCCTGGCCCAGCTGCGCA

AGGCATCAGAGAGCGAGCTGGAGCGGCAGAAGGGCTTGGTGGAGGACACCCTGCGACAGCGGCGGCAGGTGGAGGAGGAGATCATGGCGCTGAAGGTGAG

CTTTGAGAAAGCCGCCGCGGGCAAGGCAGAGCTGGAGCTGGAGCTGGGGCGCATTCGCAGCAACGCGGAGGACACAATGCGCAGCAAGGAGCAGGCGGAA

CTGGAGGCGGCCCGGCAGCGGCAGTTGGCGGCAGAGGAGGAGCAGAGGCGCCGGGAGGCCGAGGAGCGCGTGCAGAGGAGCCTGGCAGCGGAGGAGGAAG

CCGCTCGGCAGCGCAAGGTGGCACTGGAGGAGGTCGAGCGACTCAAGGCCAAGGTTGAAGAAGCACGGCGCCTGCGAGAGCGGGCAGAGCAGGAGTCGGC

CAGGCAGCTGCAGCTGGCCCAGGAGGCCGCCCAGAAACGGCTGCAGGCGGAGGAGAAGGCACACGCCTTTGTGGTGCAGCAGCGAGAGGAGGAGCTGCAG

CAGACGCTTCAGCAAGAGCAGAACATGCTGGATCGGCTGCGGAGTGAGGCAGAGGCAGCGAGGCGAGCCGCCGAGGAGGCGGAGGAGGCCCGGGAGCAGG

CGGAGCGCGAGGCAGCGCAGTCTCGGAAACAAGTGGAAGAGGCCGAGCGGCTGAAACAGTCAGCAGAGGAGCAGGCTCAGGCCCAGGCTCAGGCGCAGGC

GGCCGCAGAGAAGCTGCGCAAGGAAGCGGAGCAGGAGGCGGCGCGTCGGGCCCAGGCAGAGCAGGCAGCGCTGAAACAGAAGCAGGCAGCCGACGCGGAG

ATGGAGAAGCATAAAAAGTTTGCAGAGCAGACACTCCGGCAGAAGGCCCAGGTAGAGCAGGAGCTGACCACACTGAGGCTGCAGCTAGAGGAGACTGACC

ACCAGAAGAGCATCCTGGATGAGGAGCTGCAGCGACTAAAGGCCGAGGTAACAGAGGCAGCCCGGCAGCGCAGCCAGGTAGAGGAGGAGCTCTTCTCTGT

CCGTGTGCAGATGGAGGAGCTGGGCAAGCTCAAGGCTCGCATTGAAGCTGAAAACCGGGCCCTCATCCTTCGTGACAAGGACAACACACAGCGCTTCCTG

GAGGAGGAGGCCGAGAAGATGAAACAGGTGGCCGAGGAAGCGGCACGGTTGAGCGTGGCCGCCCAGGAGGCAGCACGGCTGAGGCAGCTAGCGGAGGAGG

ACCTGGCGCAGCAGCGGGCCCTGGCAGAGAAGATGCTGAAGGAGAAGATGCAGGCGGTGCAGGAAGCCACGAGGCTCAAGGCCGAGGCTGAGCTGCTGCA

GCAGCAGAAGGAGCTTGCCCAGGAGCAGGCCCGGCGGCTGCAGGAGGACAAGGAGCAAATGGCTCAGCAGTTGGTAGAGGAGACACAGGGTTTCCAGAGG

ACTCTGGAGGCCGAGCGGCAGCGGCAGCTGGAGATGAGCGCGGAGGCCGAGCGCCTCAAGCTGCGCATGGCTGAGATGAGCCGGGCTCAGGCCCGCGCGG

AGGAGGACGCCCAGCGCTTCCGGAAGCAGGCTGAAGAGATCGGCGAGAAGCTGCACCGCACTGAACTTGCGACACAGGAGAAGGTGACGTTGGTGCAGAC

GCTGGAGATCCAGCGACAGCAGAGTGACCACGATGCCGAGCGTCTGAGGGAGGCCATTGCGGAGCTGGAGCGTGAGAAGGAGAAGCTCAAGCAGGAGGCG

AAGTTACTGCAGCTCAAGTCGGAGGAG ATGCAGACTGTGCAGCAGGAGCAGATACTGCAGGAGACCCAGGCCCTGCAGAAGAGCTTCCTCTCTGAGAAG

GACAGCCTGCTGCAGCGCGAGCGCTTCATCGAGCAGGAGAAGGCCAAGCTGGAGCAGCTCTTCCAGGACGAGGTGGCTAAAGCAAAGCAGCTGCGTGAGG

AGCAGCAGCGGCAGCAGCAGCAGATGGAACAGGAAAAGCAGGAGCTGATGGCCAGCATGGAGGAGGCCAGGAGGCGGCAGCGCGAGGCTGAGGAGGGCGT

GAGGCGCAAGCAAGAGGAACTGCAGCATCTGGAGCAGCAGCGGCAGCAGCAGGAGAAGCTCCTGGCGGAGGAAAACCAGCGGCTGCGAGAGCGGCTGCAG

CGCCTGGAGGAAGAGCACCGCGCTGCCTTGGCTCACTCTGAGATCGCCACCACCCAGGCCGCTTCCACGAAGGCACTGCCCAACGGCCGGGATGCACCCG

ATGGCCCGTCCGTGGAGGCTGAACCCGAGTACACCTTTGAGGGACTACGTCAGAAGGTGCCGGCCCAGCAGCTACAGGAAGCAGGCATCCTGAGCCAGGA

GGAACTGCAGCGTTTGGCACAGGGTCACACCACGGTGGCTGAGCTCACGCAGCGGGAAGATGTGTACCGGTACCTGAAGGGCCGCAGCAGCATTGCAGGA

CTGTTACTGAAGCCCACCAATGAGAAACTGAGTGTCTACACAGCCCTACAGCGGCAGCTGCTCAGCCCCGGAACAGCTCTGATCTTGCTGGAGGCCCAGG

CAGCCTCGGGCTTCCTGCTGGATCCTGTGCGGAATCGGCGGCTGACAGTCAATGAGGCTGTGAAGGAGGGTGTCGTGGGTCCTGAGCTGCACCACAAACT

GCTGTCAGCTGAGCGTGCCGTCACCGGCTACAAGGACCCCTATACAGGGGAACAGATCTCGCTCTTCCAGGCCATGAAGAAGGACCTTATTGTCAGGGAC

CATGGCGTCCGCCTGCTGGAGGCCCAGATCGCCACCGGTGGCATCATTGATCCTGTGCACAGCCACCGTGTGCCTGTGGACGTGGCCTACAAACGTGGCT

ACTTCGATGAAGAGATGAACCGCATCTTGTCTGACCCAAGCGATGACACCAAGGGCTTCTTCGACCCCAACACCCACGAGAACCTCACTTACCTGCAGCT

GCTGGAGCGCTGTGTGGAGGACCCCGAGACCGGCCTGCGCCTCCTGCCACTCACAGATAAGGCTGCCAAGGGTGGCGAGCTGGTGTACACCGATACGGAG

GCCCGTGACGTCTTCGAAAAGGCCACCGTGTCTGCACCGTTTGGCAAGTTCCAGGGCAGGACCGTGACCATCTGGGAGATCATCAACTCGGAGTACTTCA

CGGCGGAACAGCGACGGGACCTGCTGCAGCAGTTCCGCACGGGCCACATCACGGTGGAGAAAATCATCAAAATCGTCATCACAGTGGTGGAGGAACACGA

GCGGAAGGGCCAGCTCTGCTTTGAGGGCCTCCGTGCCCTCGTGCCCGCCGCAGAGCTGCTGGACAGTGGGGTCATCAGCCACGAACTCTACCAGCAGCTG

CAGCGGGGTGAGCGTTCTGTGCGGGAAGTGGCCGAGGCGGACAGCGTGAGGCAGGCCCTGCGGGGTACCAATGTCATCGCCGGTGTGTGGCTGGAAGAAG

CAGGGCAGAAGCTGAGCATCTATGAGGCCCTGAAGAAAGACTTGCTGCAGCCAGAGGTGGCTGTGGCCTTGCTGGAGGCCCAGGCTGGCACTGGGCATAT

CATCGACCCTGCCACCAGCGCCAGGCTGACTGTGGACGAGGCGGTGCGTGCTGGCCTGGTGGGGCCTGAGCTGCACGAGAAGCTGCTGTCAGCCGAGAAG

GCCGTGACAGGCTACAGGGATCCCTACTCAGGACAGAGTGTCTCACTGTTCCAGGCCTTGAAGAAGGGTCTCATCCCCCGAGAACAGGGCCTGCGCCTGC

TGGATGCCCAGTTATCCACTGGTGGCATTGTAGACCCCAGCAAAAGCCACCGTGTGCCCCTGGATGTTGCCTATGCCCGGGGCTACCTGGACAAAGAGAC

TAACAGGGCCCTGACGTCACCCAGAGATGATGCCAGAGTCTACCATGACCCCAGCACCCAGGAGCCAGTCACCTACAGCCAGCTCCAACAGCGGTGCCGG

TCTGACCAGCTGACCGGCTTGAGCCTACTGCCACTCTCAGAGAAGGCCGTCCGGGCCCGGCAGGAGGAGGTCTACTCTGAGCTCCAGGCCCGGGAGACAC

TGGAGCAGGCCAAGGTTGAGGTTCCTGTGGGCAGCTTTAAGGGCAGGGCGATGACTGTGTGGGAGCTCATCAGCTCTGAATACTTTACTGAGGAGCAGCG

GCAGGAGTTGCTGCGGCAGTTCCGCACAGGCAAGGTCACCGTGGAGAAGGTCATCAAGATTGTCATCACCATCGTGGAGGAGGTGGAGACTCGGCGGCAG

GAGAGACTGTCCTTTAGTGGCCTCCGTGCCCCTGTGCCGGCCAGTGAGCTCCTGGACGCCAAGATCCTCAGCAGAGCTCAGTTTGACCAGCTCAAGGATG

GCAAGACATCAGTCAAAGAGCTGTCCGAGGTGGGCTCCGTGCGGACTCTGCTGCAGGGCAGCGGCTGCCTGGCCGGCATCTATCTGGAGGACTCGAAGGA

GAAAGTAACCATCTATGAGGCCATGCGCCGGGGCCTCCTCAGACCCAGCACAGCCACGCTCCTGCTGGAGGCCCAGGCAGCCACTGGTTTCCTGGTGGAC

CCTGTGCGGAACCAACGTCTGTATGTCCATGAGGCTGTCAAGGCGGGCGTAGTGGGCCCTGAACTCCATGAGAAGCTGCTGTCGGCCGAGAAGGCCGTCA

CTGGCTACAAGGATCCCTACTCGGGCAACACCATCTCGCTGTTCCAGGCCATGAAAAAGGGCCTGGTCCTCAGGGACCATGCCATCCGCCTGCTGGAGGC

CCAGGTCGCCACGGGTGGCATCATCGACCCGGTGCACAGCCACCGCCTGCCTGTGGACGTGGCCTACCAGCGTGGCTACTTCGATGAGGAGATGAACCGT

GTGCTGGCAGATCCAAGTGATGACACCAAGGGCTTCTTTGACCCCAACACCCACGAGAACCTCACCTACCTGCAGCTGCTGGAGCGCTGTGTGGAGGACC

CCGAGACCGGCCTGCGCCTCCTGCCACTCAAAGGGGCAGAGAAGACCGAGGTGGTAGAAACCACACAGGTGTATACTGAGGAGGAGACTCGGAGGGCGTT

CGAGGAGACGCAGATTGACATCCCGGGTGGTGGCAGCCACGGTGGCTCCTCCATGTCTCTGTGGGAGGTGATGCAGTCAAACATGATCCCGGAGGATCAG

CGTGCCCGGCTCATGGCTGACTTTCAGGCTGGGAGGGTAACCAAGGAACGCATGATCATTATCATCATCGAAATCATCGAGAAGACCGAGATCATCCGCC

AGCAGAACCTGGCCTCCTATGACTACGTGCGCCGCCGCCTCACTGCCGAAGACCTGTACGAGGCCCGGATCATCTCCCTTGAGACCTACAACCTCTTCCG

GGAAGGCACCAAGAACCTCCGTGAAGTGCTGGAGATGGAATCTGCCTGGCGCTACCTTTACGGCACAGGCGCGGTGGCCGGTGTCTACCTGCCTGGCTCC

AGGCAGACGCTAACCATCTACCAGGCCCTTAAGAAGGGGTTGCTGAGTGCCGAGGTGGCCCGCTTATTGCTGGAAGCACAGGCAGCCACGGGCTTCCTGC

TGGACCCAGTGAAGGGGGAGCGGCTGACCGTGGATGAGGCTGTGCGGAAGGGCCTGGTAGGCCCCGAGCTGCATGACCGCCTCCTCTCTGCCGAGCGAGC

TGTAACTGGTTACCGAGACCCCTACACGGAACAGACCATCTCACTCTTCCAGGCCATGAAGAAGGAGCTGATCCCTGCTGAGGAGGCGCTGAGGCTGCTG

GATGCGCAGCTAGCCACAGGAGGCATTGTGGACCCCCGCCTGGGTTTCCACCTCCCTCTGGAGGTGGCTTACCAACGCGGCTACCTCAATAAGGACACGC

ACGACCAGCTGTCGGAGCCCAGCGAGGTGCGCAGCTACGTGGACCCCTCCACGGATGAGCGGCTCAGCTACACACAGCTGCTCAAGCGTTGCCGCCGTGA

TGACCCCAGCGGCCAGATGCTGCTGCTGCTCTCTGATGCCCGCAAGCTGACCTTCCGCGGTCTCCGCAAGCAGATCACTGTGGAGGAGCTGGTACGCTCT

CAAGTCATGGACGAGGCCACAGCGCTACAGCTACAAGAAGGCCTGACCTCCATCGAGGAGGTCACTAAGAACCTGCAGAAGTTCCTCGAGGGTACCAGCT

GCATTGCCGGAGTCTTTGTTGATGCCACCAAGGAACGGCTCTCGGTGTACCAGGCTATGAAGAAGGGCATCATCCGCCCCGGGACAGCCTTTGAGCTCCT

GGAAGCACAGGCAGCCACCGGCTATGTCATTGACCCCATCAAGGGACTCAAGCTGACGGTGGAAGAAGCCGTTCGTATGGGTATTGTGGGCCCCGAGTTC

AAGGACAAGCTGCTGTCAGCTGAGCGTGCCGTCACTGGCTACAAGGACCCCTACTCTGGGAAACTCATCTCCCTCTTCCAGGCCATGAAGAAGGGCCTGA

TCCTGAAGGACCATGGCATCCGTCTGCTGGAGGCTCAGATCGCCACTGGGGGCATCATTGACCCCGAGGAGAGCCACCGTTTGCCTGTGGAAGTGGCCTA

TAAGCGCGGCCTCTTTGATGAGGAGATGAACGAGATCTTGACTGATCCCTCAGATGACACCAAGGGTTTCTTTGACCCCAACACAGAGGAGAACCTCACT

TACCTGCAGCTGATGGAGCGCTGCATCACTGACCCCCAGACGGGCCTGTGTCTCCTGCCCCTGAAGGAGAAGAAGCGGGAACGGAAGACATCCTCCAAGT

CCTCAGTGCGCAAGCGCCGCGTGGTGATTGTGGACCCAGAGACGGGCAAGGAGATGTCTGTGTACGAGGCCTACCGCAAGGGTCTCATTGACCACCAGAC

GTACCTGGAGTTGTCGGAGCAGGAGTGTGAGTGGGAAGAGATCACCATCTCCTCCTCAGATGGCGTCGTCAAGTCTATGATCATCGACCGCCGCTCTGGT

CGCCAGTATGACATCGACGACGCCATCACCAAGAACCTCATTGACCGCTCAGCACTGGACCAGTACCGCGCTGGTACGCTTTCGATCACTGAGTTTGCTG

ACATGCTCTCAGGCAATGCCGGTGGCTTCCGTTCCCGCTCCTCCTCTGTGGGCTCATCTTCCTCCTACCCCATCAGTTCTGCTGGCCCCAGGACCCAGCT

AGCCTCCTGGTCTGATCCGACTGAGGAGACTGGCCCCGTGGCCGGCATCCTGGACACAGAGACTCTGGAGAAGGTGTCCATCACGGAGGCCATGCACCGC

AACCTGGTAGACAACATCACCGGCCAGCGGCTGCTGGAGGCCCAAGCCTGCACCGGGGGCATCATTGACCCCAGCACTGGTGAGCGCTTCCCGGTCACTG

AAGCTGTCAACAAGGGCCTGGTGGACAAGATCATGGTAGACCGTATCAATCTGGCCCAGAAGGCCTTCTGTGGGTTTGAGGACCCACGCACCAAGACCAA

GATGTCAGCTGCCCAGGCCCTGAAGAAGGGCTGGCTGTACTATGAGGCAGGCCAGCGTTTCCTGGAGGTGCAGTACCTGACCGGTGGTCTGATCGAGCCT

GACACGCCCGGCCGTGTGTCTCTCGACGAAGCTCTGCAACGTGGCACTGTGGATGCCCGCACAGCCCAGAAGCTGCGTGATGTCAGTGCTTACTCCAAGT

ACCTCACGTGCCCCAAGACCAAGCTCAAGATCTCCTACAAGGACGCTCTGGACCGTAGCATGGTGGAGGAGGGCACGGGGCTGAGGCTGCTGGAGGCTGC

GGCACAGTCCAGCAAGGGCTACTACAGCCCGTACAGCGTCAGTGGCTCTGGCTCGACCGCCGGCTCACGCACTGGTTCACGCACCGGCTCCAGGGCCGGC

TCCCGGCGTGGCAGCTTTGATGCCACTGGCTCTGGCTTCTCCATGACCTTTTCTTCTTCCTCCTACTCTTCCTCAGGCTATGGCCGCCGCTATGCCTCAG

GGCCTTCAGCCTCTCTTGGGGGCCCTGAGTCTGCAGTGGCCTGATCCCCTCAGCCTGCATCCTGCCTTCCCGCTCTGCATGTGGCCGGGCTCCCTGTGGA

GGCACTGGGGTCTTCTTTTTTTTTTTCTTTTTTTTTCCTTTTTAACATTTAAAGGTGTCTTCCTCCCAAGCGGTGCCTAAAATCTAACCAAAAAGACCAG

ACTAACACATTAATATATGTATGCGATGTCCAGACAGCCTGTGTCTTGGGGAACAGGGCTGGCCCAGGCCCAGTGACCACTTCAATCTCCTGGGTTCTCC

CTAAATCCTTTCTACCTGCCACTCACCACAGCCAGGTGCCTTGGAGAATCCAGAGCTGGGCATTCAGCCTATACCACTCCTGTCTCTCCTGGGAGGATTC

TATCTGGGAAAGGCCCCCAGACCTCTAAGCCAACCCCACTGGATGTCTACCTGCTGGTCCTAGCTGCTGAGGGGAACTGGGGACAGTCGTGTGAGCAGAC

AGCTCTTGAGGCCTCTGTCCTGAGCCAGCTGCTTCTCCCCAGTCTATCTCTGAATGTCCTGTATATTCAGTGGGTTTTGCTGGCCAAGGGAAGATCCCAG

GCCAACCATCTCTTCCAGCCTACCCAGAGAAGCCCCTTCCCCATGGGAAGATAAGGCCTGGTCCTGGCCCCAGCCTCCCGCCTGGCTCCTGCAGCTGCCA

TTGGAGCTATGCTTTGTAGCTCAACACCCCATACTTATTCCCCTGAGACCTGAGCCTCTGCTTCAGCCTTCCAGCCTCAGCTCCCCTTGTAAGTGCCTTC

TGTGTCCTTGTACCCAGGCCCTAAAGACCCAGACCCAGGGTAGGAGATGGACATTCTGGCTGGGCGGGGCTGGAGGGTTCTGCAGATCTGAGACTTCTCC

TGCTCCAGAGGCCCAGGGACTCTTCAAGCCTGTGGAACCCCTCTCTGGGTGCTGCTGCCCACCTCACTCCCAGGGAGCCCTGGCCCCTCCATGGCCCAGA

GACACCGGCTGGCCCATCTATGCTAACAGAAGCATTTGGCCAGTGACACTCTCCCTTCCTTCCTGTCCAGCCAGTCCCGGGCCTTGGTGGCTCCTCCCCT

GCCTCCACCCTCTGAGTGAGCTTTGCATGTTCCACTAACCTTGAGCTGGTGGCAGGTGGAGATGCCAGGCAGAACACTAACCTGACCATGGGCGGGGCCC

TGCGGTGTCCGCCCCTCAATAAAAGCAATTCCAACCTT
Translation
MSGEDSEVRPVAVAEGSSNGSSGSPSPGDTLPWNLGKTQRSRRSGGGSVGNGSVLDPAERAVIRIAD DERDRVQKKTFTKWVNKHLIK HWRAE AQRH

ISDLYEDLRDGHNLISLLEVLSGDSL PRERDVIRSVRL PREKGRMRFHKLQNVQIALDYLRHRQ VKLVNIRNDDIADGNPKLTLGLIWTIILHFQ I

SDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHK KPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED DVD

VPQPDEKSIITYVSSLYDAMPRVPGAQDGVRAN ELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIE ILWCQFLKFKETELPAKEADKNRSK

VIYQSLE - UNI2348 - GAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFER RLECLQRIVSKLQMEAGLCEEQLNQADALLQS DIR

LLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRR RVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYL

QDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDE SQLSPATRGAYRDCLGRLDLQYAKLL NSSKARLRSLESLHGFVA

AATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYS ALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVE SFQAALQTQWSWMLQLCCCIEAHLKEN

TAYFQ FFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQ DEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVE

 VTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVAR RLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVT FR

TLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQG GEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDK

DPARECAQRIAEQQ - UNI6584 - KAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEK - UNI192 - K

LKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLK KLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLE

RWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEK ALLEEIERHGEKVEECQKFAKQYINAIK DYEL

QLITYKAQLEPVASPAKKPKVQSGSESVIQE YVDLRTRYSELTTLTSQYIKFISETLRRMEEEE RLAEQQRAEERERLAEVEAALEKQRQLAEAHAQA

KAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARA

EEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKR

ASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQ

AVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTS

EKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEE

QAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQR

RREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSE

AEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKA

QVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAAR

LSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEA

ERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEE MQTVQQ

EQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQ

QQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAEL

TQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYT

GEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLL

PLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVP

AAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAV

RAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYH

DPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVE

KVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRP

STATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHR

LPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGG

SSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESA

WRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISL

FQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARK

LTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKG

LKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTD

PSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEIT

ISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAG

ILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYE

AGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSG

SGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA

For any suggestions or comments, please send an email to unitrap@crg.es