Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022601 (Rpl24)
Chromosomal location
Chr 16: 55966456 - 55980834 (+)
Description
ribosomal protein L24 Gene [Source:MGI (curated);Acc:Rpl24-005]
RefSeq_dna
NM_024218 
RefSeq_peptide
NP_077180.1 
UniGene
Mm.303028 Mm.360789 
MGI
MGI:1915443 
Uniprot/SWISSPROT
Q8BP67 
Uniprot/SPTREMBL
Q3UW40 Q8BT08 Q9CS31 
Human Ortholog
not available
Omim not available
UniTrap UNI13286
Vector Insertion
Chr 16: 55966552 - 55966659
Public Clones CMHD-GT_336D9-3 (cmhd)
Private Clones OST124539 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20626
Vector Insertion
Chr 16: 55966736 - 55967172
Public Clones not available
Private Clones OST356276 (lexicon) OST232888 (lexicon) OST232323 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24644
Vector Insertion
Chr 16: 55967284 - 55969622
Public Clones H003C11 (ggtc)
Private Clones OST211537 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8062
Vector Insertion
Chr 16: 55969760 - 55970224
Public Clones RRJ234 (baygenomics) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33912
Vector Insertion
Chr 16: 55971548 - 55980707
Public Clones PST18689-NR (escells) IST10887D7 (tigm) IST11868A5 (tigm) IST14356E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023269
Sequence
CTCTTCGCCATCTTTACCCCGGCAGGCCGACATCTATCACCATGAA - UNI13286 - GGTCGAGCTGTGCAGTTTCAGCGGGTACAAGATCTACCCG

GGACACGGGCGGCGCTACGCCAGGACCGACGGGAAG - UNI20626 - GTTTTCCAGTTTCTTAATGCAAAATGTGAGTCAGCATTCCTTTCCAAAAG

GAATCCTCGGCAGATAAACTGGACTGTCCTCTACAGAAGGAAACACAAGAAAGGGCAGTCG - UNI24644 - GAAGAAATTCAAAAGAAAAGAACCC

GCCGTGCAGTCAAATTCCAACGAGCCATCACTGGTGCATCTCTTGCTGATATAATGGCCAAGAGGAATCAGAAACCAGAGGTTAGGAAAGCCCAGCGAGA

GCAGGCTATCAG - UNI8062 - GGCTGCCAAGGAAGCAAAAAAGGCTAAGCAGGCATCAAAGAAGACAGCAATGGCTGCTGCCAAG GCCCCCACAA

AGGCAGCACCTAAACAAAAGATTGTGAAGCCTGTGAAGGTCTCTGCCCCCAGAGTTGGTGGGAAACGCTAGTGTGGTAGAGCAGAGTTGGAAATAAAGCT

CTATCTTTAACTCT
Translation
MK - UNI13286 - KVELCSFSGYKIYPGHGRRYARTDGK - UNI20626 - VFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQS - UNI2

4644 - EEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIR - UNI8062 - RAAKEAKKAKQASKKTAMAAAK APTKAAPKQKI

VKPVKVSAPRVGGKR
Transcript ENSMUST00000122365
Sequence
AGGAGATTCTCTCCCTCTGCCCTATAAGGTTCTCCCATGATTCTTTCTTTCTCTTCGCCATCTTTACCCCGGCAGGCCGACATCTATCACCATGAA - U

NI13286 - GGTCGAGCTGTGCAGTTTCAGCGGGTACAAGATCTACCCGGGACACGGGCGGCGCTACGCCAGGACCGACGGGAAG - UNI20626 - 

GTTTTCCAGTTTCTTAATGCAAAATGTGAGTCAGCATTCCTTTCCAAAAGGAATCCTCGGCAGATAAACTGGACTGTCCTCTACAGAAGGAAACACAAGA

AAGGGCAGTCG - UNI24644 - GAAGAAATTCAAAAGAAAAGAACCCGCCGTGCAGTCAAATTCCAACGAGCCATCACTGGTGCATCTCTTGCTGAT

ATAATGGCCAAGAGGAATCAGAAACCAGAGGTTAGGAAAGCCCAGCGAGAGCAGGCTATCAG - UNI8062 - GGCTGCCAAGGAAGCAAAAAAGGCT

AAGCAGGCATCAAAGAAGACAGCAATGGCTGCTGCCAAG - UNI33912 - GTATATTAAAGCAAGTTAAAGATTACATAAAACAGTGTAGCAAATGT

CAGGAGAAGCTCGATCGCTCCCGTCCAATATCGGATGCTTCGGAAATGTTGGAAGAGTTGGGGTTGGATCTTGACTCTGG
Translation
MK - UNI13286 - KVELCSFSGYKIYPGHGRRYARTDGK - UNI20626 - VFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQS - UNI2

4644 - EEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIR - UNI8062 - RAAKEAKKAKQASKKTAMAAAK - UNI33912 

- VY
Transcript ENSMUST00000114450
Sequence
TCTTTCTCTTCGCCATCTTTACCCCGGCAGGCCGACATCTATCACCATGAA - UNI13286 - GGTCGAGCTGTGCAGTTTCAGCGGGTACAAGATCT

ACCCGGGACACGGGCGGCGCTACGCCAGGACCGACGGGAAG - UNI20626 - GTTTTCCAGTTTCTTAATGCAAAATGTGAGTCAGCATTCCTTTCC

AAAAGGAATCCTCGGCAGATAAACTGGACTGTCCTCTACAGAAGGAAACACAAGAAAGGGCAGTCG - UNI24644 - GAAGAAATTCAAAAGAAAAG

AACCCGCCGTGCAGTCAAATTCCAACGAGCCATCACTGGTGCATCTCTTGCTGATATAATGGCCAAGAGGAATCAGAAACCAGAGGTTAGGAAAGCCCAG

CGAGAGCAGGCTATCAG - UNI8062 - GGCTGCCAAGGAAGCAAAAAAGGCTAAGCAGGCATCAAAGAAGACAGCAATGGCTGCTGCCAAG GCCCC

CACAAAGGCAGCACCTAAACAAAAGATTGTGAAGCCTGTGAAGGTCTCTGCCCCCAGAGTTGGTGGGAAACGCTAGTGTGGTAGAGCAGAGTTGGAAATA

AAGCTCTATCTTTAACTCT
Translation
LSLRHLYPGRPTSITMK - UNI13286 - KVELCSFSGYKIYPGHGRRYARTDGK - UNI20626 - VFQFLNAKCESAFLSKRNPRQINWTVLYR

RKHKKGQS - UNI24644 - EEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIR - UNI8062 - RAAKEAKKAKQASKKTAMA

AAK APTKAAPKQKIVKPVKVSAPRVGGKR

For any suggestions or comments, please send an email to unitrap@crg.es