Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022621 (Rabl2a)
Chromosomal location
Chr 15: 89412968 - 89422296 (-)
Description
RAB, member of RAS oncogene family-like 2A Gene [Source:MGI Symbol;Acc:MGI:1915958]
RefSeq_peptide
NP_081093.2 
UniGene
Mm.23258 
MGI
MGI:1915958 
Uniprot/SPTREMBL
Q3TDG7 Q8K2P9 Q9D133 
Human Ortholog
ENSG00000079974 (RABL2B)
Omim not available
UniTrap UNI29733
Vector Insertion
Chr 15: 89418618 - 89420858
Public Clones E089G02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094056
Sequence
AGAGACGCGGCCGAGCTGCTGCGGGACTGCAGTCATCTGTAAACGG - UNI29733 - ACGGTGACGAGACCCCGGGGCTGGCAGTCGTCTGCCAACA

AGAGCCGATGGCAGGGGACAGAAACAGGCACTGTGAGCTGGAGCAGGAGAAGTACGACACCCATGAGAACGTGAAGATCATCTGCCTGGGGGACAGTGCG

GTGGGCAAGTCCAA - UNI29733 - GTATTTGATGTCCAGAGGAAAATCACCTATAAGAACCTGGGTACCTG CAGACATACAGATGACTCAAAAGA

ATTTCAGTTTTGCCAAGAAGTTCTCCCTGCCCCTGTACTTTGTCTCGGCTGCTGATGGTACCAATGTTGTGAAG CTCTTCAATGATGCTATTCGATTAG

CTGTGGCTTACAAAGAGAGTTCCCAGGACTTCATGGACGAGGTTTTACAGGAGCTCGAG AACTTCAAGTTGGAGCAGAAAGAAGAGGATACGTCAGGCC

AAGAGCAGAGTGACACGACCAAGAGCCCATCTCCTTCCTAACCTGAGGACATCCACACATGGCAGAGTTGGGGTATTGGGAGCCATTTGGAACACCCTAC

ATCTCTGGAGAACATCTCTAGGCTACCCCTGCTCAACTTCCTGCAAACCCACTGTTCTGTGGTACATGATGAGGTCAATACAAAGAAACTAGACAGGCGT

GATACCCACCATCTTCCTGCATCAGGATGAGGGATCCGTGTCATTCACACACACACCCCGACCCCCACCCCCACCCCAGCAGCCTGATAGTGCAGAAACA

GTGAACATGCTCATGTCTTCTTAGTAGACATTTAGGTGTTTGTTGTCTTTCTTCCCAAACTGACCTCAGGGACTGTCCCTTCACTTCTGCCGAGAGAATG

ATGCAAACCCTTGAGGACGATGTGTTCCTATGGAATCCATCTGTGACACCTCTGTCCCTGTCAACAATATTTTTGACAGACAACCATTAATTCCAAATTT

GCTTTTCTAGCACCAACTGTTTTGGGAGCTCTTCTCGGTCAGTTGAGAGCACAGCAGCAGGACTCGATTGCAGTGCAGTGAAGACAAGTGTAGCCATATC

TGCTTATACACACACCTTACTGTTCCCCACCACGTGAACAAAAACTGCCTCCATCTCAGGGTAGAAAGCCTTCCTCCACCTCTCTAGGGCGAGTTAAGCA

CTGCGTCTTCTGTGGGTGGCAGCAGACAGCAGGGAAGAGCTGCCCTGCTTCTCTGCAGCTTGCTAGATGATGTCACGATTGTCTTGAGCATCATTTGCAT

TATCATTATTTTGTTTATATTGTCTCCTTTTTTTACAATAAAGATAAAGTTTCG
Translation
 - UNI29733 - MAGDRNRHCELEQEKYDTHENVKIICLGDSAVGKSK - UNI29733 - KYLMSRGKSPIRTWVPA ADIQMTQKNFSFAKKFSL

PLYFVSAADGTNVVK LFNDAIRLAVAYKESSQDFMDEVLQELE NFKLEQKEEDTSGQEQSDTTKSPSPS
Transcript ENSMUST00000023294
Sequence
AGAGACGCGGCCGAGCTGCTGCGGGACTGCAGTCATCTGTAAACGG - UNI29733 - ACGGTGACGAGACCCCGGGGCTGGCAGTCGTCTGCCAACA

AGAGCCGATGGCAGGGGACAGAAACAGGCACTGTGAGCTGGAGCAGGAGAAGTACGACACCCATGAGAACGTGAAGATCATCTGCCTGGGGGACAGTGCG

GTGGGCAAGTCCAA - UNI29733 - ACTCATGGAGAGATTTCTCATGGATGGATT - UNI29733 - CCAGCCACAGCAACTGTCCACATATGCT

CTGACTCTGTATAAGCACACAGCCACAGTAGACGGCAAGACGATCCTTGTGG ACTTCTGGGATACAGCAGGCCAGGAGCGGTTCCAGAGCATGCATGCT

TCCTACTACCACAAGGCTCACGCCTGCATCATG GTATTTGATGTCCAGAGGAAAATCACCTATAAGAACCTGGGTACCTGGTATGCAGAACTTCGGGAG

TTCAGGCCGGAGATCCCATGCATCCTGGTGGCCAATAAAATTGATG CAGACATACAGATGACTCAAAAGAATTTCAGTTTTGCCAAGAAGTTCTCCCTG

CCCCTGTACTTTGTCTCGGCTGCTGATGGTACCAATGTTGTGAAG CTCTTCAATGATGCTATTCGATTAGCTGTGGCTTACAAAGAGAGTTCCCAGGAC

TTCATGGACGAGGTTTTACAGGAGCTCGAG AACTTCAAGTTGGAGCAGAAAGAAGAGGATACGTCAGGCCAAGAGCAGAGTGACACGACCAAGAGCCCA

TCTCCTTCCTAACCTGAGGACATCCACACATGGCAGAGTTGGGGTATTGGGAGCCATTTGGAACACCCTACATCTCTGGAGAACATCTCTAGGCTACCCC

TGCTCAACTTCCTGCAAACCCACTGTTCTGTGGTACATGATGAGGTCAATACAAAGAAACTAGACAGGCGTGATACCCACCATCTTCCTGCATCAGGATG

AGGGATCCGTGTCATTCACACACACACCCCGACCCCCACCCCCACCCCAGCAGCCTGATAGTGCAGAAACAGTGAACATGCTCATGTCTTCTTAGTAGAC

ATTTAGGTGTTTGTTGTCTTTCTTCCCAAACTGACCTCAGGGACTGTCCCTTCACTTCTGCCGAGAGAATGATGCAAACCCTTGAGGACGATGTGTTCCT

ATGGAATCCATCTGTGACACCTCTGTCCCTGTCAACAATATTTTTGACAGACAACCATTAATTCCAAATTTGCTTTTCTAGCACCAACTGTTTTGGGAGC

TCTTCTCGGTCAGTTGAGAGCACAGCAGCAGGACTCGATTGCAGTGCAGTGAAGACAAGTGTAGCCATATCTGCTTATACACACACCTTACTGTTCCCCA

CCACGTGAACAAAAACTGCCTCCATCTCAGGGTAGAAAGCCTTCCTCCACCTCTCTAGGGCGAGTTAAGCACTGCGTCTTCTGTGGGTGGCAGCAGACAG

CAGGGAAGAGCTGCCCTGCTTCTCTGCAGCTTGCTAGATGATGTCACGATTGTCTTGAGCATCATTTGCATTATCATTATTTTGTTTATATTGTCTCCTT

TTTTTACAATAAAGATAAAGTTTCG
Translation
 - UNI29733 - MAGDRNRHCELEQEKYDTHENVKIICLGDSAVGKSK - UNI29733 - KLMERFLMDGF - UNI29733 - FQPQQLSTYAL

TLYKHTATVDGKTILVD DFWDTAGQERFQSMHASYYHKAHACIM VFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDA ADIQMTQKNFSFAKK

FSLPLYFVSAADGTNVVK LFNDAIRLAVAYKESSQDFMDEVLQELE NFKLEQKEEDTSGQEQSDTTKSPSPS
Transcript ENSMUST00000058058
Sequence
AGAGACGCGGCCGAGCTGCTGCGGGACTGCAGTCATCTGTAAACGG - UNI29733 - ACGGTGACGAGACCCCGGGGCTGGCAGTCGTCTGCCAACA

AGAGCCGATGGCAGGGGACAGAAACAGGCACTGTGAGCTGGAGCAGGAGAAGTACGACACCCATGAGAACGTGAAGATCATCTGCCTGGGGGACAGTGCG

GTGGGCAAGTCCAA - UNI29733 - ACTCATGGAGAGATTTCTCATGGATGGATT - UNI29733 - CCAGCCACAGCAACTGTCCACATATGCT

CTGACTCTGTATAAGCACACAGCCACAGTAGACGGCAAGACGATCCTTGTGG ACTTCTGGGATACAGCAGGCCAGGAGCGGTTCCAGAGCATGCATGCT

TCCTACTACCACAAGGCTCACGCCTGCATCATG GTATTTGATGTCCAGAGGAAAATCACCTATAAGAACCTGGGTACCTGGTATGCAGAACTTCGGGAG

TTCAGGCCGGAGATCCCATGCATCCTGGTGGCCAATAAAATTGATGGTGGGGCC TCCCTGCACCTGGGTGACAGTAATTCCTGGGGACCAAGCACCACA

CATTTCCTTCTTTCAAAGAATGGCCCACCTTTGTTTCCCTTCCCAAGATGCTCCCTTTCTAGTAGGGAGGCCAGCAGCGAGACCCTGTCTTCCCAAGACA

CAGACCCATATTACCCATGTCAAGGGCAGTCCCTGACAGTCCCTTCCCCTCTCACCCTGCCTCCAAACTCTTCCCATTGCCTGGGTGGACAAGCCAATGC

CCCACTTCTCTCTGCAGCAGACATACAGATGACTCAAAAGAATTTCAGTTTTGCCAAGAAGTTCTCCCTGCCCCTGTACTTTGTCTCGGCTGCTGATGGT

ACCAATGTTGTGAAG AACTTCAAGTTGGAGCAGAAAGAAGAGGATACGTCAGGCCAAGAGCAGAGTGACACGACCAAGAGCCCATCTCCTTCCTAACCT

GAGGACATCCACACATGGCAGAGTTGGGGTATTGGGAGCCATTTGGAACACCCTACATCTCTGGAGAACATCTCTAGGCTACCCCTGCTCAACTTCCTGC

AAACCCACTGTTCTGTGGTACATGATGAGGTCAATACAAAGAAACTAGACAGGCGTGATACCCACCATCTTCCTGCATCAGGATGAGGGATCCGTGTCAT

TCACACACACACCCCGACCCCCACCCCCACCCCAGCAGCCTGATAGTGCAGAAACAGTGAACATGCTCATGTCTTCTTAGTAGACATTTAGGTGTTTGTT

GTCTTTCTTCCCAAACTGACCTCAGGGACTGTCCCTTCACTTCTGCCGAGAGAATGATGCAAACCCTTGAGGACGATGTGTTCCTATGGAATCCATCTGT

GACACCTCTGTCCCTGTCAACAATATTTTTGACAGACAACCATTAATTCCAAATTTGCTTTTCTAGCACCAACTGTTTTGGGAGCTCTTCTCGGTCAGTT

GAGAGCACAGCAGCAGGACTCGATTGCAGTGCAGTGAAGACAAGTGTAGCCATATCTGCTTATACACACACCTTACTGTTCCCCACCACGTGAACAAAAA

CTGCCTCCATCTCAGGGTAGAAAGCCTTCCTCCACCTCTCTAGGGCGAGTTAAGCACTGCGTCTTCTGTGGGTGGCAGCAGACAGCAGGGAAGAGCTGCC

CTGCTTCTCTGCAGCTTGCTAGATGATGTCACGATTGTCTTGAGCATCATTTGCATTATCATTATTTTGTTTATATTGTCTCCTTTTTTTACAATAAAGA

TAAAGTTTCG
Translation
 - UNI29733 - MAGDRNRHCELEQEKYDTHENVKIICLGDSAVGKSK - UNI29733 - KLMERFLMDGF - UNI29733 - FQPQQLSTYAL

TLYKHTATVDGKTILVD DFWDTAGQERFQSMHASYYHKAHACIM VFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDGGA SLHLGDSNSWGPS

TTHFLLSKNGPPLFPFPRCSLSSREASSETLSSQDTDPYYPCQGQSLTVPSPLTLPPNSSHCLGGQANAPLLSAADIQMTQKNFSFAKKFSLPLYFVSAA

DGTNVVK NFKLEQKEEDTSGQEQSDTTKSPSPS

For any suggestions or comments, please send an email to unitrap@crg.es