Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022678 (Nde1)
Chromosomal location
Chr 16: 14163380 - 14192921 (+)
Description
nuclear distribution gene E homolog 1 (A nidulans) Gene [Source:MGI (curated);Acc:Nde1-006]
RefSeq_peptide
NP_075806.2 NP_001107557.1 
MGI
MGI:1914453 
Uniprot/SWISSPROT
Q9CZA6 
Human Ortholog
ENSG00000072864 (NDE1)
Omim not available
UniTrap UNI11950
Vector Insertion
Chr 16: 14163462 - 14169544
Public Clones (sanger) P015E10 (ggtc) PST4312-NR (escells) IST14198B4 (tigm) IST14730C11 (tigm)
IST10987B11 (tigm)
Private Clones OST427648 (lexicon) OST416144 (lexicon) OST292411 (lexicon) OST261109 (lexicon)
OST260479 (lexicon) OST235322 (lexicon) OST189927 (lexicon) OST134680 (lexicon)
OST130694 (lexicon) OST106438 (lexicon) OST32210 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19459
Vector Insertion
Chr 16: 14169669 - 14170430
Public Clones not available
Private Clones OST390854 (lexicon) OST238333 (lexicon) OST84884 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22726
Vector Insertion
Chr 16: 14170585 - 14175383
Public Clones not available
Private Clones OST286220 (lexicon) OST262260 (lexicon) OST195726 (lexicon) OST56092 (lexicon)
OST42914 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20370
Vector Insertion
Chr 16: 14192434 - 14192922
Public Clones not available
Private Clones OST365387 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115794
Sequence
GCTTTTGCCCATTTTACCATGGAGGACTCGGGAAAGACCTTTGAATCAGAGGAGGAAGAAACAAACTATTGGAGAGACCTGGCCATGACCTACAAACAGA

G - UNI19459 - GGCAGAGAATACTCAGGAAGAACTCAGAGAGTTCCAGGAAGGAAGCCGAGAATACGAAGCTGAATTGGAGGCTCAGCTGCAGCAG

ATTGAAACCAGGAACCGGGACCTCTTGTCAGAGAATAACCGCCTTCGCATGGAGCTGGAGTCTGTGAAG - UNI22726 - AGCCACAATCATGTCCC

TGGAAGACTTTGAGCAGCGTTTGAATCAAGCCATTGAAAGAAATGCCTTCCTAGAGAGTGAGCTGGATGAGAAGGAGAATCTTCTAGAATCTGTGCAGAG

GCTGAAGGATGAAGCCCGAG ATCTGCGGCAGGAATTGGCTGTGCAACAGAAGCAAGACAAGCCCCGGACACCCATGCCAGGCTCAGGGCAAGCCAAGAG

GACAGACATGGCTGTGCAGGCCACAGGCTCTGTACCGTCTACTCCAGTAGCTCACCGAGGACCTAGCTCTGGTTTGAACACACCAGGAATGTTCAGACGT

G GTCTGGACAGCTCCACTAGTGGGACGCCACTCACACCTGCAGCCCGGATATCAGCCCTAAACATCGTTGGGGACCTGCTTCGGAAAGTTGGG GCCCT

GGAGTCCAAGCTAGCATCATGCAGGAACTTCATGTATGATCAGTCCCCAAGCCGGACAAGTGGGCCAGCCTCAGGACGAGGAACCAAAAACAGAGATGGT

GTTGACAGAAGGCCAGGCAGTACCAGTGTGGGCGATAAAGG GTCAGGAAAACGCTTGGAGTTTGGGAAGCCAGCCTCAGAGCCAGCATCACCAGCGCTA

CCATCCGCCCAGGGTGTGGTCAAGCTTTTGCTTTAGGACCAATGAGAACTGCGCCCTCCCCTGTCTTCCTTACTTTATAGTCGGCTTTTAGTCGCTTTAT

TTTCAAGGTAGTTTGAGAAATAAGAGCCAGTATCACCAGCGTTCACTTTGTGCCGTGTAGCCTAAACTGACTACGGCTGGTGGTGGTGGCCTTGGCATCA

TCCCTGTGATGTGGCTCAGTCCCTAGCAGTGTGTGTCATGGAAATGAGCTCACACACACACAGACACCCCGCACAAGGCAGCTCTAACGTATGATGCCAC

TGGCTTCCTAGAGTTTTAATGGCCTCCAGAGGTGTTTTGCTCAGGAGCTCTCTGCAGCCTGCTTCCAGCTGAAGCTGTCTTCTGGAACATTCTCCTGGTG

CTTTTACAGCATGATCAAATTGTATCTAGGACTGGGAGATTACAGAGGCAAAAAAAGGCTTTATTAAACTATGGTCATGTACCTTTGACACTTTAACGCT

GTCTGCCTCTTAAGTCAGTGGGAGACTATCCTCTATCGATAAACCCTGACTCCTGTTTTTCTTGAGATCCCTTCCCTGATGTTGGGGTGGCATGTGCATC

AAGACACTGGACAACTTGCGTTGCACTGGCCTTTGTTACATCATCCCTAAGAACAGAACTTCATCCAGCCAGCTGGGCTTCATTCAGACACCATAGAGCA

ACCAGGGTGGTAAAGCCGGAGATGGAGCTCACCGCCAGACGCGCCCTCGGGATGTGGAAAGACCAGCACAGGCTCTGCAAATGCCAGCTCG
Translation
 - UNI19459 -  - UNI22726 - MSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARD DLRQELAVQQKQDKPRTPMPGSGQAKRT

DMAVQATGSVPSTPVAHRGPSSGLNTPGMFRRG GLDSSTSGTPLTPAARISALNIVGDLLRKVG ALESKLASCRNFMYDQSPSRTSGPASGRGTKNRD

GVDRRPGSTSVGDKG GSGKRLEFGKPASEPASPALPSAQGVVKLLL
Transcript ENSMUST00000115795
Sequence
GGCTGGAGGGCAAGAAAGGCCTGCCGGCCCGCGCCTCGCTGGAATCGTCGCCGCCCGGGCTGG - UNI11950 - ACATCATGCCACAGGAAGAGTGA

GCTTTTGCCCATTTTACCATGGAGGACTCGGGAAAGACCTTTGAATCAGAGGAGGAAGAAACAAACTATTGGAGAGACCTGGCCATGACCTACAAACAGA

G - UNI19459 - GGCAGAGAATACTCAGGAAGAACTCAGAGAGTTCCAGGAAGGAAGCCGAGAATACGAAGCTGAATTGGAGGCTCAGCTGCAGCAG

ATTGAAACCAGGAACCGGGACCTCTTGTCAGAGAATAACCGCCTTCGCATGGAGCTGGAGTCTGTGAAG - UNI22726 - GAGAAGTTTGAGATGCA

GCACTCAGAGGGTTACCGGCAGATCTCAGCCTTGGAGGATGACCTGGCGCAGACGAAAGCCATTAAAGACCAACTGCAGAAATACATTAGGGAACTGGAA

CAAGCCAATGATGACCTGGAAAGAGCCAAACG AGCCACAATCATGTCCCTGGAAGACTTTGAGCAGCGTTTGAATCAAGCCATTGAAAGAAATGCCTTC

CTAGAGAGTGAGCTGGATGAGAAGGAGAATCTTCTAGAATCTGTGCAGAGGCTGAAGGATGAAGCCCGAG ATCTGCGGCAGGAATTGGCTGTGCAACAG

AAGCAAGACAAGCCCCGGACACCCATGCCAGGCTCAGGGCAAGCCAAGAGGACAGACATGGCTGTGCAGGCCACAGGCTCTGTACCGTCTACTCCAGTAG

CTCACCGAGGACCTAGCTCTGGTTTGAACACACCAGGAATGTTCAGACGTG GTCTGGACAGCTCCACTAGTGGGACGCCACTCACACCTGCAGCCCGGA

TATCAGCCCTAAACATCGTTGGGGACCTGCTTCGGAAAGTTGGG GCCCTGGAGTCCAAGCTAGCATCATGCAGGAACTTCATGTATGATCAGTCCCCAA

GCCGGACAAGTGGGCCAGCCTCAGGACGAGGAACCAAAAACAGAGATGGTGTTGACAGAAGGCCAGGCAGTACCAGTGTGGGCGATAAAGG GAGAGAAA

ATTGA
Translation
 - UNI11950 - MEDSGKTFESEEEETNYWRDLAMTYKQR - UNI19459 - RAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRL

RMELESVK - UNI22726 - EKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKR RATIMSLEDFEQRLNQAIERNAFLESE

LDEKENLLESVQRLKDEARD DLRQELAVQQKQDKPRTPMPGSGQAKRTDMAVQATGSVPSTPVAHRGPSSGLNTPGMFRRG GLDSSTSGTPLTPAARI

SALNIVGDLLRKVG ALESKLASCRNFMYDQSPSRTSGPASGRGTKNRDGVDRRPGSTSVGDKG GREN
Transcript ENSMUST00000023359
Sequence
GGCTGGAGGGCAAGAAAGGCCTGCCGGCCCGCGCCTCGCTGGAATCGTCGCCGCCCGGGCTGG - UNI11950 - ACATCATGCCACAGGAAGAGTGA

GCTTTTGCCCATTTTACCATGGAGGACTCGGGAAAGACCTTTGAATCAGAGGAGGAAGAAACAAACTATTGGAGAGACCTGGCCATGACCTACAAACAGA

G - UNI19459 - GGCAGAGAATACTCAGGAAGAACTCAGAGAGTTCCAGGAAGGAAGCCGAGAATACGAAGCTGAATTGGAGGCTCAGCTGCAGCAG

ATTGAAACCAGGAACCGGGACCTCTTGTCAGAGAATAACCGCCTTCGCATGGAGCTGGAGTCTGTGAAG - UNI22726 - GAGAAGTTTGAGATGCA

GCACTCAGAGGGTTACCGGCAGATCTCAGCCTTGGAGGATGACCTGGCGCAGACGAAAGCCATTAAAGACCAACTGCAGAAATACATTAGGGAACTGGAA

CAAGCCAATGATGACCTGGAAAGAGCCAAACG AGCCACAATCATGTCCCTGGAAGACTTTGAGCAGCGTTTGAATCAAGCCATTGAAAGAAATGCCTTC

CTAGAGAGTGAGCTGGATGAGAAGGAGAATCTTCTAGAATCTGTGCAGAGGCTGAAGGATGAAGCCCGAG ATCTGCGGCAGGAATTGGCTGTGCAACAG

AAGCAAGACAAGCCCCGGACACCCATGCCAGGCTCAGGGCAAGCCAAGAGGACAGACATGGCTGTGCAGGCCACAGGCTCTGTACCGTCTACTCCAGTAG

CTCACCGAGGACCTAGCTCTGGTTTGAACACACCAGGAATGTTCAGACGTG GTCTGGACAGCTCCACTAGTGGGACGCCACTCACACCTGCAGCCCGGA

TATCAGCCCTAAACATCGTTGGGGACCTGCTTCGGAAAGTTGGG GCCCTGGAGTCCAAGCTAGCATCATGCAGGAACTTCATGTATGATCAGTCCCCAA

GCCGGACAAGTGGGCCAGCCTCAGGACGAGGAACCAAAAACAGAGATGGTGTTGACAGAAGGCCAGGCAGTACCAGTGTGGGCGATAAAGG GTCAGGAA

AACGCTTGGAGTTTGGGAAGCCAGCCTCAGAGCCAGCATCACCAGCGCTACCATCCGCCCAGGGTGTGGTCAAGCTTTTGCTTTAGGACCAATGAGAACT

GCGCCCTCCCCTGTCTTCCTTACTTTATAGTCGGCTTTTAGTCGCTTTATTTTCAAGGTAGTTTGAGAAATAAGAGCCAGTATCACCAGCGTTCACTTTG

TGCCGTGTAGCCTAAACTGACTACGGCTGGTGGTGGTGGCCTTGGCATCATCCCTGTGATGTGGCTCAGTCCCTAGCAGTGTGTGTCATGGAAATGAGCT

CACACACACACAGACACCCCGCACAAGGCAGCTCTAACGTATGATGCCACTGGCTTCCTAGAGTTTTAATGGCCTCCAGAGGTGTTTTGCTCAGGAGCTC

TCTGCAGCCTGCTTCCAGCTGAAGCTGTCTTCTGGAACATTCTCCTGGTGCTTTTACAGCATGATCAAATTGTATCTAGGACTGGGAGATTACAGAGGCA

AAAAAAGGCTTTATTAAACTATGGTCATGTACCTTTGACACTTTAACGCTGTCTGCCTCTTAAGTCAGTGGGAGACTATCCTCTATCGATAAACCCTGAC

TCCTGTTTTTCTTGAGATCCCTTCCCTGATGTTGGGGTGGCATGTGCATCAAGACACTGGACAACTTGCGTTGCACTGGCCTTTGTTACATCATCCCTAA

GAACAGAACTTCATCCAGCCAGCTGGGCTTCATTCAGACACCATAGAGCAACCAGGGTGGTAAAGCCGGAGATGGAGCTCACCGCCAGACGCGCCCTCGG

GATGTGGAAAGACCAGCACAGGCTCTGCAAATGCCAGCTCGTCTCTCATCTCTGGGGTGTAGCGCTGCCCCACACTTCAGTGCACAATGAGAAAAGCACA

CTAATACCAGAGCTTGGCACCCTTCACTGGCTACTAACTTATTTTCTAGTTGATGGGTAAAACTGGCCTAGAGTTGGACCTAGAACTTTTCGTGTGCTAC

TGACATTACAAGGTGATTTTAAGCTGCTGGCTATTTGTTCTCCTTAGACATAATAACCTGGGGAAAGATGGACTTTATTTTTTATAAGAAATAAAATAAA

ACC
Translation
 - UNI11950 - MEDSGKTFESEEEETNYWRDLAMTYKQR - UNI19459 - RAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRL

RMELESVK - UNI22726 - EKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKR RATIMSLEDFEQRLNQAIERNAFLESE

LDEKENLLESVQRLKDEARD DLRQELAVQQKQDKPRTPMPGSGQAKRTDMAVQATGSVPSTPVAHRGPSSGLNTPGMFRRG GLDSSTSGTPLTPAARI

SALNIVGDLLRKVG ALESKLASCRNFMYDQSPSRTSGPASGRGTKNRDGVDRRPGSTSVGDKG GSGKRLEFGKPASEPASPALPSAQGVVKLLL
Transcript ENSMUST00000117958
Sequence
CACCGCGCAGTACCGGCGAGGCTGGAGGGCAAGAAAGGCCTGCCGGCCCGCGCCTCGCTGGAATCGTCGCCGCCCGGGCTGG - UNI11950 - ACAT

CATGCCACAGGAAGAGTGAGCTTTTGCCCATTTTACCATGGAGGACTCGGGAAAGACCTTTGAATCAGAGGAGGAAGAAACAAACTATTGGAGAGACCTG

GCCATGACCTACAAACAGAG - UNI19459 - GGCAGAGAATACTCAGGAAGAACTCAGAGAGTTCCAGGAAGGAAGCCGAGAATACGAAGCTGAATT

GGAGGCTCAGCTGCAGCAGATTGAAACCAGGAACCGGGACCTCTTGTCAGAGAATAACCGCCTTCGCATGGAGCTGGAGTCTGTGAAG - UNI22726 

- GAGAAGTTTGAGATGCAGCACTCAGAGGGTTACCGGCAGATCTCAGCCTTGGAGGATGACCTGGCGCAGACGAAAGCCATTAAAGACCAACTGCAGAA

ATACATTAGGGAACTGGAACAAGCCAATGATGACCTGGAAAGAGCCAAACG AGCCACAATCATGTCCCTGGAAGACTTTGAGCAGCGTTTGAATCAAGC

CATTGAAAGAAATGCCTTCCTAGAGAGTGAGCTGGATGAGAAGGAGAATCTTCTAGAATCTGTGCAGAGGCTGAAGGATGAAGCCCGAG ATCTGCGGCA

GGAATTGGCTGTGCAACAGAAGCAAGACAAGCCCCGGACACCCATGCCAGGCTCAGGGCAAGCCAAGAGGACAGACATGGCTGTGCAGGCCACAGGCTCT

GTACCGTCTACTCCAGTAGCTCACCGAGGACCTAGCTCTGGTTTGAACACACCAGGAATGTTCAGACGTG GTCTGGACAGCTCCACTAGTGGGACGCCA

CTCACACCTGCAGCCCGGATATCAGCCCTAAACATCGTTGGGGACCTGCTTCGGAAAGTTGGG GCCCTGGAGTCCAAGCTAGCATCATGCAGGAACTTC

ATGTATGATCAGTCCCCAAGCCGGACAAGTGGGCCAGCCTCAGGACGAGGAACCAAAAACAGAGATGGTGTTGACAGAAGGCCAGGCAGTACCAGTGTGG

GCGATAAAGG - UNI20370 - ATCCCTTCCCTGATGTTGGGGTGGCATGTGCATCAAGACACTGGACAACTTGCGTTGCACTGGCCTTTGTTACATC

ATCCCTAAGAACAGAACTTCATCCAGCCAGCTGGGCTTCATTCAGACACCATAGAGCAACCAGGGTGGTAAAGCCGGAGATGGAGCTCACCGCCAGACGC

GCCCTCGGGATGTGGAAAGACCAGCACAGGCTCTGCAAATGCCAGCTCGTCTCTCATCTCTGGGGTGTAGCGCTGCCCCACACTTCAGTGCACAATGAGA

AAAGCACACTAATACCAGAGCTTGGCACCCTTCACTGGCTACTAACTTATTTTCTAGTTGATGGGTAAAACTGGCCTAGAGTTGGACCTAGAACTTTTCG

TGTGCTACTGACATTACAAGGTGATTTTAAGCTGCTGGCTATTTGTTCTCCTTAGACATAATAACCTGGGGAAAGATGGACTTTATTTTTTATAAGAAAT

AAAATAAAACC
Translation
 - UNI11950 - MEDSGKTFESEEEETNYWRDLAMTYKQR - UNI19459 - RAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRL

RMELESVK - UNI22726 - EKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKR RATIMSLEDFEQRLNQAIERNAFLESE

LDEKENLLESVQRLKDEARD DLRQELAVQQKQDKPRTPMPGSGQAKRTDMAVQATGSVPSTPVAHRGPSSGLNTPGMFRRG GLDSSTSGTPLTPAARI

SALNIVGDLLRKVG ALESKLASCRNFMYDQSPSRTSGPASGRGTKNRDGVDRRPGSTSVGDKG - UNI20370 - GSLP

For any suggestions or comments, please send an email to unitrap@crg.es