Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022718 (Dgcr8)
Chromosomal location
Chr 16: 18254043 - 18289342 (-)
Description
DiGeorge syndrome critical region gene 8 Gene [Source:MGI (curated);Acc:Dgcr8-002]
RefSeq_dna
NM_033324 
RefSeq_peptide
NP_201581.2 
MGI
MGI:2151114 
Uniprot/SWISSPROT
Q9EQM6 
Human Ortholog
ENSG00000128191 (DGCR8)
Omim not available
UniTrap UNI10756
Vector Insertion
Chr 16: 18289195 - 18289282
Public Clones P145C08 (ggtc) P149D03 (ggtc) M059B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11042
Vector Insertion
Chr 16: 18285402 - 18289195
Public Clones (sanger) M059A07 (ggtc) P145C08 (ggtc) D018E11 (ggtc) P107F05 (ggtc)
D106A10 (ggtc) P121C08 (ggtc) P103A04 (ggtc) P097B09 (ggtc) PST3609-NR (escells)
PST4278-NR (escells) PST15175-NL (escells) PST675-1 (escells) PST11044-NR (escells)
PST4767-NR (escells) PST22086-NR (escells) IST14637D11 (tigm) IST14971H8 (tigm)
IST11585C4 (tigm) IST14351E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15072
Vector Insertion
Chr 16: 18283789 - 18285402
Public Clones PST13727-NL (escells) PST21388-NL (escells) PST4757-NL (escells) PST6594-NR (escells)
Private Clones OST453244 (lexicon) OST201162 (lexicon) OST175233 (lexicon) OST142291 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30458
Vector Insertion
Chr 16: 18280850 - 18283216
Public Clones CMHD-GT_328B10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15372
Vector Insertion
Chr 16: 18278411 - 18280596
Public Clones PST9490-NL (escells) PST3210-NR (escells) PST4637-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37628
Vector Insertion
Chr 16: 18278131 - 18278610
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14846
Vector Insertion
Chr 16: 18277258 - 18278234
Public Clones CMHD-GT_487H5-3 (cmhd) PST5315-NL (escells) PST12475-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9380
Vector Insertion
Chr 16: 18272897 - 18277258
Public Clones (sanger) XH085 (baygenomics) XH157 (baygenomics) XG058 (baygenomics)
PST2553-NL (escells) PST2553-NR (escells) PST4867-NL (escells) PST4867-NR (escells)
PST13377-NR (escells)
Private Clones OST385889 (lexicon) OST300898 (lexicon) OST168498 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18209
Vector Insertion
Chr 16: 18260073 - 18272813
Public Clones not available
Private Clones OST427490 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115633
Sequence
CGCCTTCCGCTCGCCCGCGCGGCAGCGGGTCTCAAGAGCCGAGCGCTTTGCAAGGGCCTTCGCGGGTTGTGGCGGCGCCGGGGTCGGTGAGGGTCGACCG

GCTGTGGTCGGGCTGCGGGCGGCTCGGGCAGGTCGCGGGCGCCACAG - UNI10756 - - UNI11042 - - UNI15072 - ACACCCTTCCTCT

ACTGGGAATGGATCTATGCTGCCACTCCTGGTGACCTCAGCACGCTGCATCACTGTCCTGTCCACGTGCCACGTTGTGGGCCCAGGAGAGGGGGTCCCTG

GGTAGCAGAGTGCCTGGCTATATCTCTGAGGTCTCTAGTGCCACAGAGTTGAGCTGAGGGTCTCACTCGCCCTCTGACTGACCCAGCCCTTGCAG - UN

I15072 - GTGGAAGAAGAAAGGTGCCACTTTGGCATGAAGATAGACTCACTTAGACGTCAATCTTTTAAGCTGAGTGCATTGTGATTTCCAATAATTG

AGGCAGTGGTTCTAAAAGCTGTCTACATTAATGAAAAGAGCAATGTGGCCAGCTTGACTAAGCCGCCAGTGTGTACAGCGCGGGCAGGACGACACCGGGT

CTCGACGGACTTGTGCATGTTAGCAGTATAGATTTATGTAAGGTGGTTTAAAACTCTGGTCTTTTAAAGTAGTCTTAACTGCTCATAATATGGAGACATA

TGAGAGTCCCTCTCCTCTCCCGCGTGAGCCCGCAGGAGAAGCGATGATGGAGAACCGAGCTTGCCCCTTCCAAGTGCTGCCCCATGAACAGTCTCCACCA

CCTCCCCTGCAAACGTCCAGTGATGCAGAGGTAATGGACGTTGGCTCTGGTGGTGATGGACAGTCCGAACCTCCTGCCGACGACCCATTCAACTTCTACG

GAGCTTCTCTTCTCTCCAAAGGATCCTTCTCTAAGGGCCGCCTCCTCATAGACCCGAACTGTAGTGGCCACAGCCCGCGCACTGCCCGGCACGCACCTGC

GGTCCGGAAGTTCTCCCCTGACCTTAAGTTGCTTAAGGATGTAAAGATTAGCGTGAGCTTTACTGAGAGCTGCAGGAGTAAGGACAGGAAGGTGCTGTAC

ACAGGAGTAGAACGCAGCACTCGGCCTGAGTGTGGCCAGCTCCTTAGTCCTGTCAGTGGGGACGTGCATGCTTGTCCCTTTGGCGGGAGTGTTGGTAATG

GGGTAGGCCTAGGGGGTGAGAGTGCAGATAAGAAGGATGAGGAAAATGAGCTGGATCAGGAAAAGAGAGTGGAGTATGCAGTGCTCGATGAGTTAGAAGA

TTTTACTGACAATTTGGAGCTAGATGAAGAAGGAACAGGCGGGTTCACGGCTAAAGCAATCGTTCAAAGAGACAGAGTGGATGAAGAGGCCTTGAATTTC

TCCTATGAG - UNI15072 - GATGACTTTGACAATGATGTGGACGCTTTACTAGAAGAAGGTCTCTGTGCTCCCAAGAAGAGGCGAATGGAGGAAAA

ATATGGCGGAGACAGTGATCATCCATCTGATGGAGAGACAAGTGTACAGCCAATGATGACCAAGATTAAAACAGTGCTCAAAA - UNI30458 - GTC

GTGGCCGTCCACCTACAGAGCCATTGCCTGATGGATGGATCATGACTTTTCATAATTCTGGAGTCCCTGTATACCTGCACAGAGAGTCTCGAGTGGTCAC

TTGGTCCAGACCCTACTTCTTGGGAACAGGAAGCATACGG - UNI15372 - AAACATGATCCTCCTCTAAGCAGTATCCCCTGCCTACATTATAAGA

AAATGAAGGACAATGAGGAACGAGAACAAAACTGTGATCTTGCCCCCAGTGGAGAGGTGTCACCTGTCAAGCCCTTGGGTCGGTCTGCAGAGTTGGATTT

CCCTCTGGAAGAGCCTGACTCCATGGGTGGAGACTCAGGGTCCATGGATGAGAAGGACCCATTGGGGGCTGAGGCAGCCGCTGGAGCCCTGGGACAAGTG

AAGGCTAAAGTTGAGGTGTGCAAAGATGAATCAGTTG - UNI15372 - ATCTGGAGGAATTTCGTAATTACCTTGAGAAGCGTTTTGACTTTGAACA

AGTAACTGTGAAAAAATTCAGGACTTGGGCTGAGCGGCGTCAGTTCAACCGTGAGATGAAGCGGAAGCAGGCCGAGTCAGAGAGGCCCATCCTGCCAGCC

AACCAGAAGCTGATCACTCTATCTGTACAAGATGCACCCACAAAGAAAG - UNI14846 - - UNI15372 - AGTTTGTCATCAATCCCAATGGGA

AGTCTGAGGTTTGCATCCTGCACGAATACATGCAGCGTGTCCTCAAGGTCCGCCCTGTTTATAATTTCTTTGAATGTG - UNI14846 - AGAATCCA

AGTGAGCCTTTTGGTGCCTCCGTGACCATTGATGGTGTGACTTACGGATCTGGAACTGCAAGCAGCAAAAAACTTGCGAAGAATAAAGCTG - UNI938

0 - - UNI14846 - CCCGAGCCACCCTGGAAATTCTCATCCCTGACTTTGTTAAACAGACCTCTGAGGAGAAGCCTAAAGACAGTGAAGAACTGGAG

 - UNI18209 - TATTTTAACCACATCAGTATTGAGGATTCACGAGTCTATGAGCTGACAAGCAAGGCTGGGCTGTTGTCTCCATATCAGATCCTCCA

TGAGTGCCTTAAAAG AAACCATGGAATGGGTGACACATCCATCAAGTTTGAAGTGGTTCCTGGGAAAAACCAGAAGAGTGAATATGTTATGGCATGCGG

CAAACACACAGTGCGCGGGTGGT GTAAGAATAAACGAGTTGGGAAACAATTAGCATCTCAGAAAATCCTTCAGCTACTGCACCCACATGTCAAGAACTG

GGGTTCCTTACTACGCATGTATGGTCGTGAGAGCAGCAAAATGGTCAAGCAG GAGACCTCTGACAAGAGTGTGATAGAGCTACAGCAGTATGCCAAGAA

GAACAGGCCCAACCTTCACATCCTGAGCAAGCTACAAGAAGAGATGAAGAGGCTGGCTGCAGAGCGG GAGGAGACTCGGAAGAAACCCAAGATGTCAAT

TGTAGCATCTGCCCAGCCTGGTGGTGAGCCCTTGTGCACAGTCGATGTATGAGGTAGGCAGCATGGGCCAACAGTGCTACCCAGGAGAGACCATCAGCCA

CACATCATCACTCTGCAGCTCCAGGCCTCCAACCTAAGTTCCTTCCCTGTGGCAGGGTCTGGGCTCTGGCTCTGGCACATGGGGACAGCTGTGACTACAC

AGTACACATGCAAAGAAGCAGTTCTGGACAAGCTGCTCTCAATGTGACTGGATATACTTAAGGATCAGTCATAAGTTAACTGCACAAGTGGAAGCTGATA

GACAGCTGTAGATCCTGCTTGTATGTATCTGCTGCGGACCGTTTTTATGAAGGTTTTCATTAATTTTAGTACACTATATGCACTGACAAGAAGTAATACT

TCGTTGATAGATGAGATGACCAGGTTTTATAGCTTTGGCTGGCCTATGATGCCAGGTAGCCCCTTTGCTATGGTTCTTTCTGGTGGAGCCACTGAGACTT

GGTCAGAAGATGCAGGTATCCTGTCCTGTAGAATTACCTGCTTTGTGTGTTTTGCATTTTCTTCTGAAAAAGTTATAACAGAAAGGAATATTTCAGGCTA

TTTTGGCTTAAAATAAAACAAAATTTTAGCACCAGAAATACTCTTCCGAGATTGCAGTGAAGATACTGAGTGTTAGTCCGATTGATCCTTTTTCTTATGA

AGTCTTAATGTCCTAACAGCCGTCTTCTGGATACTGAAGCTTCCACCTTCGATAAACTTAGCAACAATTTTTTACAGAGATTTTTGCACAACCAAGCCCA

TCTGTTCATCAATTTTTAAAGCTTTTATGATGTTTTAAAATTTGGAAAGAAACTTTTACAGTAAGAATGAAAGATGCATTTCAACAGATGAATATGCATA

AATAGGGAACTGGCCTTCAATGTAGCCCATCACTGACCAAGAGCTGCCTGGCACATTGTACACGATAAGTAGTTATGGTGTTTTTTGATCTCAAGGATAG

CTGCTCTGTGCAGCCAGGCCTGATTGCAGGTTTTTGTCTACCTATGCTCATTGGATAGCCCCTGTAAATGGGTATTGAGTAGAGGGGTATTCAGAGCCCT

ATTACCTGTTCAGAGGGGCTACACTCTACATCCTCAGTGTCTCTAACCATGTACCTGAAGATACATGGGTGACATGTGCTGTTAGAAAGATAAGATGGCA

ACTGTGGGCCTCCCAACAGCATCTTCCTCCTCCTTAATCATGTGTGTGACAGCAGTTAATGTTTATGTTAATCTTGGCAAAAAGAACCCTTAATTCAAGT

TGGTAGACTTGGACACTTGATTCTTTTCTGCCTCCCATTCAGTTGTGTTCAGTCTTTTGACTAACCATTGCCCTTAAAACATACTTAACATTGAAAAAGC

ATATGGTAATGGTGGTATCTCTGCAGCCTCACCGACCCAGGCACTGTCAACAGGTGCTGCCACACATTCCTGGTCTCCAGTGCCCTCCCTGTCTCTTACA

GGTGGGTCTTATATGTACAGTCATGCTGCAAGGGTGGGGAGCCTGTGCTGATGTGCTTCTGTGTGTTGGCCAAGGCTGTAGGGTGTACCCTGATGGTCTG

AACACATAAAACTGTCC
Translation
 - UNI10756 - - UNI11042 - - UNI15072 -  - UNI15072 - METYESPSPLPREPAGEAMMENRACPFQVLPHEQSPPPPLQTSSDA

EVMDVGSGGDGQSEPPADDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGVERSTRP

ECGQLLSPVSGDVHACPFGGSVGNGVGLGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGTGGFTAKAIVQRDRVDEEALNFSYE - UNI

15072 - DDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDHPSDGETSVQPMMTKIKTVLKS - UNI30458 - SRGRPPTEPLPDGWIMTFHNSGVP

VYLHRESRVVTWSRPYFLGTGSIR - UNI15372 - KHDPPLSSIPCLHYKKMKDNEEREQNCDLAPSGEVSPVKPLGRSAELDFPLEEPDSMGGDSG

SMDEKDPLGAEAAAGALGQVKAKVEVCKDESVD - UNI15372 - DLEEFRNYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQK

LITLSVQDAPTKKE - UNI14846 - - UNI15372 - EFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECE - UNI14846 - ENPSEPFGAS

VTIDGVTYGSGTASSKKLAKNKAA - UNI9380 - - UNI14846 - ARATLEILIPDFVKQTSEEKPKDSEELE - UNI18209 - YFNHISIE

DSRVYELTSKAGLLSPYQILHECLKR RNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWC CKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR

ESSKMVKQ ETSDKSVIELQQYAKKNRPNLHILSKLQEEMKRLAAER EETRKKPKMSIVASAQPGGEPLCTVDV
Transcript ENSMUST00000009321
Sequence
GCGGGTTGTGGCGGCGCCGGGGTCGGTGAGGGTCGACCGGCTGTGGTCGGGCTGCGGGCGGCTCGGGCAGGTCGCGGGCGCCACAG - UNI10756 - 

- UNI11042 - - UNI15072 - GTGGAAGAAGAAAGGTGCCACTTTGGCATGAAGATAGACTCACTTAGACGTCAATCTTTTAAGCTGAGTGCATT

GTGATTTCCAATAATTGAGGCAGTGGTTCTAAAAGCTGTCTACATTAATGAAAAGAGCAATGTGGCCAGCTTGACTAAGCCGCCAGTGTGTACAGCGCGG

GCAGGACGACACCGGGTCTCGACGGACTTGTGCATGTTAGCAGTATAGATTTATGTAAGGTGGTTTAAAACTCTGGTCTTTTAAAGTAGTCTTAACTGCT

CATAATATGGAGACATATGAGAGTCCCTCTCCTCTCCCGCGTGAGCCCGCAGGAGAAGCGATGATGGAGAACCGAGCTTGCCCCTTCCAAGTGCTGCCCC

ATGAACAGTCTCCACCACCTCCCCTGCAAACGTCCAGTGATGCAGAGGTAATGGACGTTGGCTCTGGTGGTGATGGACAGTCCGAACCTCCTGCCGACGA

CCCATTCAACTTCTACGGAGCTTCTCTTCTCTCCAAAGGATCCTTCTCTAAGGGCCGCCTCCTCATAGACCCGAACTGTAGTGGCCACAGCCCGCGCACT

GCCCGGCACGCACCTGCGGTCCGGAAGTTCTCCCCTGACCTTAAGTTGCTTAAGGATGTAAAGATTAGCGTGAGCTTTACTGAGAGCTGCAGGAGTAAGG

ACAGGAAGGTGCTGTACACAGGAGTAGAACGCAGCACTCGGCCTGAGTGTGGCCAGCTCCTTAGTCCTGTCAGTGGGGACGTGCATGCTTGTCCCTTTGG

CGGGAGTGTTGGTAATGGGGTAGGCCTAGGGGGTGAGAGTGCAGATAAGAAGGATGAGGAAAATGAGCTGGATCAGGAAAAGAGAGTGGAGTATGCAGTG

CTCGATGAGTTAGAAGATTTTACTGACAATTTGGAGCTAGATGAAGAAGGAACAGGCGGGTTCACGGCTAAAGCAATCGTTCAAAGAGACAGAGTGGATG

AAGAGGCCTTGAATTTCTCCTATGAG - UNI15072 - GATGACTTTGACAATGATGTGGACGCTTTACTAGAAGAAGGTCTCTGTGCTCCCAAGAAG

AGGCGAATGGAGGAAAAATATGGCGGAGACAGTGATCATCCATCTGATGGAGAGACAAGTGTACAGCCAATGATGACCAAGATTAAAACAGTGCTCAAAA

 - UNI30458 - GTCGTGGCCGTCCACCTACAGAGCCATTGCCTGATGGATGGATCATGACTTTTCATAATTCTGGAGTCCCTGTATACCTGCACAGA

GAGTCTCGAGTGGTCACTTGGTCCAGACCCTACTTCTTGGGAACAGGAAGCATACGG - UNI15372 - AAACATGATCCTCCTCTAAGCAGTATCCC

CTGCCTACATTATAAGAAAATGAAGGACAATGAGGAACGAGAACAAAACTGTGATCTTGCCCCCAGTGGAGAGGTGTCACCTGTCAAGCCCTTGGGTCGG

TCTGCAGAGTTGGATTTCCCTCTGGAAGAGCCTGACTCCATGGGTGGAGACTCAGGGTCCATGGATGAGAAGGACCCATTGGGGGCTGAGGCAGCCGCTG

GAGCCCTGGGACAAGTGAAGGCTAAAGTTGAGGTGTGCAAAGATGAATCAGTTG - UNI15372 - ATCTGGAGGAATTTCGTAATTACCTTGAGAAG

CGTTTTGACTTTGAACAAGTAACTGTGAAAAAATTCAGGACTTGGGCTGAGCGGCGTCAGTTCAACCGTGAGATGAAGCGGAAGCAGGCCGAGTCAGAGA

GGCCCATCCTGCCAGCCAACCAGAAGCTGATCACTCTATCTGTACAAGATGCACCCACAAAGAAAG - UNI14846 - - UNI15372 - AGTTTGT

CATCAATCCCAATGGGAAGTCTGAGGTTTGCATCCTGCACGAATACATGCAGCGTGTCCTCAAGGTCCGCCCTGTTTATAATTTCTTTGAATGTG - UN

I14846 - AGAATCCAAGTGAGCCTTTTGGTGCCTCCGTGACCATTGATGGTGTGACTTACGGATCTGGAACTGCAAGCAGCAAAAAACTTGCGAAGAA

TAAAGCTG - UNI9380 - - UNI14846 - CCCGAGCCACCCTGGAAATTCTCATCCCTGACTTTGTTAAACAGACCTCTGAGGAGAAGCCTAAAG

ACAGTGAAGAACTGGAG - UNI18209 - TATTTTAACCACATCAGTATTGAGGATTCACGAGTCTATGAGCTGACAAGCAAGGCTGGGCTGTTGTCT

CCATATCAGATCCTCCATGAGTGCCTTAAAAG AAACCATGGAATGGGTGACACATCCATCAAGTTTGAAGTGGTTCCTGGGAAAAACCAGAAGAGTGAA

TATGTTATGGCATGCGGCAAACACACAGTGCGCGGGTGGT GTAAGAATAAACGAGTTGGGAAACAATTAGCATCTCAGAAAATCCTTCAGCTACTGCAC

CCACATGTCAAGAACTGGGGTTCCTTACTACGCATGTATGGTCGTGAGAGCAGCAAAATGGTCAAGCAG GAGACCTCTGACAAGAGTGTGATAGAGCTA

CAGCAGTATGCCAAGAAGAACAGGCCCAACCTTCACATCCTGAGCAAGCTACAAGAAGAGATGAAGAGGCTGGCTGCAGAGCGG GAGGAGACTCGGAAG

AAACCCAAGATGTCAATTGTAGCATCTGCCCAGCCTGGTGGTGAGCCCTTGTGCACAGTCGATGTATGAGGTAGGCAGCATGGGCCAACAGTGCTACCCA

GGAGAGACCATCAGCCACACATCATCACTCTGCAGCTCCAGGCCTCCAACCTAAGTTCCTTCCCTGTGGCAGGGTCTGGGCTCTGGCTCTGGCACATGGG

GACAGCTGTGACTACACAGTACACATGCAAAGAAGCAGTTCTGGACAAGCTGCTCTCAATGTGACTGGATATACTTAAGGATCAGTCATAAGTTAACTGC

ACAAGTGGAAGCTGATAGACAGCTGTAGATCCTGCTTGTATGTATCTGCTGCGGACCGTTTTTATGAAGGTTTTCATTAATTTTAGTACACTATATGCAC

TGACAAGAAGTAATACTTCGTTGATAGATGAGATGACCAGGTTTTATAGCTTTGGCTGGCCTATGATGCCAGGTAGCCCCTTTGCTATGGTTCTTTCTGG

TGGAGCCACTGAGACTTGGTCAGAAGATGCAGGTATCCTGTCCTGTAGAATTACCTGCTTTGTGTGTTTTGCATTTTCTTCTGAAAAAGTTATAACAGAA

AGGAATATTTCAGGCTATTTTGGCTTAAAATAAAACAAAATTTTAGCACCAGAAATACTCTTCCGAGATTGCAGTGAAGATACTGAGTGTTAGTCCGATT

GATCCTTTTTCTTATGAAGTCTTAATGTCCTAACAGCCGTCTTCTGGATACTGAAGCTTCCACCTTCGATAAACTTAGCAACAATTTTTTACAGAGATTT

TTGCACAACCAAGCCCATCTGTTCATCAATTTTTAAAGCTTTTATGATGTTTTAAAATTTGGAAAGAAACTTTTACAGTAAGAATGAAAGATGCATTTCA

ACAGATGAATATGCATAAATAGGGAACTGGCCTTCAATGTAGCCCATCACTGACCAAGAGCTGCCTGGCACATTGTACACGATAAGTAGTTATGGTGTTT

TTTGATCTCAAGGATAGCTGCTCTGTGCAGCCAGGCCTGATTGCAGGTTTTTGTCTACCTATGCTCATTGGATAGCCCCTGTAAATGGGTATTGAGTAGA

GGGGTATTCAGAGCCCTATTACCTGTTCAGAGGGGCTACACTCTACATCCTCAGTGTCTCTAACCATGTACCTGAAGATACATGGGTGACATGTGCTGTT

AGAAAGATAAGATGGCAACTGTGGGCCTCCCAACAGCATCTTCCTCCTCCTTAATCATGTGTGTGACAGCAGTTAATGTTTATGTTAATCTTGGCAAAAA

GAACCCTTAATTCAAGTTGGTAGACTTGGACACTTGATTCTTTTCTGCCTCCCATTCAGTTGTGTTCAGTCTTTTGACTAACCATTGCCCTTAAAACATA

CTTAACATTGAAAAAGCATATGGTAATGGTGGTATCTCTGCAGCCTCACCGACCCAGGCACTGTCAACAGGTGCTGCCACACATTCCTGGTCTCCAGTGC

CCTCCCTGTCTCTTACAGGTGGGTCTTATATGTACAGTCATGCTGCAAGGGTGGGGAGCCTGTGCTGATGTGCTTCTGTGTGTTGGCCAAGGCTGTAGGG

TGTACCCTGATGGTCTGAACACATAAAACTGTCCAAAAGGG
Translation
 - UNI10756 - - UNI11042 - - UNI15072 - METYESPSPLPREPAGEAMMENRACPFQVLPHEQSPPPPLQTSSDAEVMDVGSGGDGQSE

PPADDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGVERSTRPECGQLLSPVSGDVH

ACPFGGSVGNGVGLGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGTGGFTAKAIVQRDRVDEEALNFSYE - UNI15072 - DDFDND

VDALLEEGLCAPKKRRMEEKYGGDSDHPSDGETSVQPMMTKIKTVLKS - UNI30458 - SRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSR

PYFLGTGSIR - UNI15372 - KHDPPLSSIPCLHYKKMKDNEEREQNCDLAPSGEVSPVKPLGRSAELDFPLEEPDSMGGDSGSMDEKDPLGAEAAA

GALGQVKAKVEVCKDESVD - UNI15372 - DLEEFRNYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKE

 - UNI14846 - - UNI15372 - EFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECE - UNI14846 - ENPSEPFGASVTIDGVTYGSGTAS

SKKLAKNKAA - UNI9380 - - UNI14846 - ARATLEILIPDFVKQTSEEKPKDSEELE - UNI18209 - YFNHISIEDSRVYELTSKAGLL

SPYQILHECLKR RNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWC CKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQ ETSDK

SVIELQQYAKKNRPNLHILSKLQEEMKRLAAER EETRKKPKMSIVASAQPGGEPLCTVDV

For any suggestions or comments, please send an email to unitrap@crg.es