Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022773 (Ypel1)
Chromosomal location
Chr 16: 17070292 - 17086829 (+)
Description
yippee-like 1 (Drosophila) Gene [Source:MGI (curated);Acc:Ypel1-001]
RefSeq_dna
NM_023249 
RefSeq_peptide
NP_075738.1 
UniGene
Mm.237941 
MGI
MGI:1913303 
Uniprot/SWISSPROT
Q9ESC7 
Uniprot/SPTREMBL
Q65Z96 Q9DA95 Q8C1R4 
Human Ortholog
ENSG00000100027 (YPEL1)
Omim not available
UniTrap UNI19202
Vector Insertion
Chr 16: 17082160 - 17082188
Public Clones not available
Private Clones OST401888 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22521
Vector Insertion
Chr 16: 17082788 - 17084608
Public Clones not available
Private Clones OST293568 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115729
Sequence
AAACAAAGGGCAGGCGGCCCGCGAGGCGGCGGCAGGAGGATGCCTCGCGCCCGGAGTGGGCGCCAACGGCCGGAGCGCGTCCCGGGTCACACCGGGACCG

CCTGAAAACCGAGCTCGCGCCGACCGAGCCTGGGCCGGATGGGCGCAGCGGACCGCGGAGCGGCC AGTTTTACTGCCATGAACAGACACCATAACCAAG

GCAACTCTTAAAAAGACAACATTTAGCTGGGGCTGGCTTAAAGGTTCAGAGATTCAGTCCATTATCATCAAGGTGGGAGCATGGCAGCATCCAGACAGGC

ATGGCGCAGGAGGAACTGAGAGTTCTACATCTTCATCCAAAGGCTGCTAGCAGAATACTGACTTCCAGGGGGTTAG GTTGCACTGGCGTTCCCTTGCCC

CAGTGTGTGGACAGCACCACACGCCCTCCAGACCAGCAACGGCTCTTGCATATACTTTCCAGTGTTTTTGTCAGAGAGTCCGACAGAGCCCTAGCTCCTC

CAGAGCTGGCCCAGAACCGAGTGACGAGAGCCCAGCAGACATGGTGAAAATGACCAAGTCCAAAACTTTCCAAGCTTATCTGCCACACTGTCACCGAACT

TACAGCTGCATCCACTGCAGAGCCCATCTGGCCAATCACGATGAGCTTATCTCCAAG TCCTTTCAGGGAAGCCAGGGGCGAGCCTACCTCTTCAACTCT

GT - UNI19202 - GGTGAATGTGGGCTGTGGCCCCGCTGA
Translation
  MVKMTKSKTFQAYLPHCHRTYSCIHCRAHLANHDELISK SFQGSQGRAYLFNSV - UNI19202 - VVNVGCGPA
Transcript ENSMUST00000090199
Sequence
AAACCGAGCTCGCGCCGACCGAGCCTGGGCCGGATGGGCGCAGCGGACCGCGGAGCGGCC GTTGCACTGGCGTTCCCTTGCCCCAGTGTGTGGACAGCA

CCACACGCCCTCCAGACCAGCAACGGCTCTTGCATATACTTTCCAGTGTTTTTGTCAGAGAGTCCGACAGAGCCCTAGCTCCTCCAGAGCTGGCCCAGAA

CCGAGTGACGAGAGCCCAGCAGACATGGTGAAAATGACCAAGTCCAAAACTTTCCAAGCTTATCTGCCACACTGTCACCGAACTTACAGCTGCATCCACT

GCAGAGCCCATCTGGCCAATCACGATGAGCTTATCTCCAAG TCCTTTCAGGGAAGCCAGGGGCGAGCCTACCTCTTCAACTCTGT - UNI19202 - 

GGTGAATGTGGGCTGTGGCCCCGCTGAGGAGAGAGTCCTTCTAACCGGGCTGCATGCAGTGGCCGACATCTACTGTGAGAACTGCAAGACCACACTCGGG

TGGAAATAC GGCAGAGCACACCTTGTCCACCACGACACTCTTCAGGCACAAAGGTCAATGCAGTCCTGGGCTCTCCCAGAGCTCTGTGCTCAGACCTTG

GCCTGCCTGTCTCCAGCTTCTCTCCATACATAAATTGATTGACATCTC
Translation
 MVKMTKSKTFQAYLPHCHRTYSCIHCRAHLANHDELISK SFQGSQGRAYLFNSV - UNI19202 - VVNVGCGPAEERVLLTGLHAVADIYCENCK

TTLGWKY GRAHLVHHDTLQAQRSMQSWALPELCAQTLACLSPASLHT
Transcript ENSMUST00000035682
Sequence
AGGAGGATGCCTCGCGCCCGGAGTGGGCGCCAACGGCCGGAGCGCGTCCCGGGTCACACCGGGACCGCCTGAAAACCGAGCTCGCGCCGACCGAGCCTGG

GCCGGATGGGCGCAGCGGACCGCGGAGCGGCC GTTGCACTGGCGTTCCCTTGCCCCAGTGTGTGGACAGCACCACACGCCCTCCAGACCAGCAACGGCT

CTTGCATATACTTTCCAGTGTTTTTGTCAGAGAGTCCGACAGAGCCCTAGCTCCTCCAGAGCTGGCCCAGAACCGAGTGACGAGAGCCCAGCAGACATGG

TGAAAATGACCAAGTCCAAAACTTTCCAAGCTTATCTGCCACACTGTCACCGAACTTACAGCTGCATCCACTGCAGAGCCCATCTGGCCAATCACGATGA

GCTTATCTCCAAG TCCTTTCAGGGAAGCCAGGGGCGAGCCTACCTCTTCAACTCTGT - UNI19202 - GGTGAATGTGGGCTGTGGCCCCGCTGAG

GAGAGAGTCCTTCTAACCGGGCTGCATGCAGTGGCCGACATCTACTGTGAGAACTGCAAGACCACACTCGGGTGGAAATAC - UNI22521 - GAACA

TGCCTTTGAGAGCAGTCAGAAATACAAGGAAGGAAAATTTATTATTGAACTTGCCCACATGATCAAAGACAACGGCTGGTAAAGTGAAGCGGTCCACTCC

TGTTTGAATCCTATTTTATGAAAGCTGAGTGTACAGAAGACCTAGCTTCTTGGTGACAATGCTTCTTGAACTTAACCTCACAGGCCAGCCCAGTCTCAAC

ACTTGAAGGTGTCTCTCTAGGCTATCCACTTGGTAAGGTGCCCATTTGAATCCCTGTCGTGTACAATGCGTTTTTGGAAGTCTGAGTTCTTTTTCTAACA

TCTTAAGTTCTAGAGAAAGAATTGACCAGCTGGTGACTCACCTGCCTAGTGAATACTTTCTTTTACCCTACGCCTGCAATGCCTGGCTGTGTTCTCACCA

AGCCCAAGTCCCTAAAAGCAGAGAAGCAAGGTCTCCTCACAAGCAAAGGCATAGTTACCAGAAGTAAAGCATGTCTCCAAAAACTGAAACCAGCCACTGG

TAACATGGAAGAGAAGCTAGGAAGCAAGCATTCAGTGTACATCTTAAGCAAATAGGGAGGTTCCTGATGTAGAAGGCGAGTGACTTACTGGTGGCTGAAC

GCTCTGTCCCAGGGCTACCCAAGTCTGCCACTGAGCTGACTCCCTTGGTGCTGCGGCAGCACAGCGGCTCAGAATGTAGGGCTGGTCCCTGCCACAGAGC

AACAGGCTGGGTTTCACTTTATACCCTGGATGTACTTGAAATAGTTATGCATACAGAGGCCAGAGCCAGTACGGGAAACTGCAAAACATGAGAGTTTTCC

AAGGTAAAGGAAGAGTTAGCTTAGTATGGGAGCTACCTTTTCTGCCTGGAATCACCTCATGACCTGACAAGGGAGGATCTGGGCCATCCCCCAAGCCCAG

GCTCTCAGATTTTAAGTCACAACACATCATACTCTATAAGGAGTGGCCAATTTGCAGAGAGGATGGAGGCCAGAACCATTCCCAGATAAGTTTCATTGTT

TTGTACCCTCCCCAGGGCAGAAGGGCAGGCAGTAGGCCTGTGAAGGCTGAGAGCCCTTGAGCTGCAAAGGCAGCATTACAGGAAAGCGCTTAGCACCGGC

TGCTCTAGAGCTGCCTGGGTGTGGTAGTCAAAAAGCAGTTTCTATCTAGACCTTTGGGCTCCAGCCCCAGACCTGCTAAACCCACATCCTCTGGCCAGCA

CAGGCACTCGCTACTCCTCTTCACTTCAAAACCTACATTTTGGTGCCATTTCTTTGCCCAAGATTGGAAGGCTGGTAATACAGGAAATGCCTGCGCAATG

CTGGTCCTAGCCCAAGCTGCTTTTTCCCCAGCTACTTCCAGTTTCCCTCTAGACTAAGGCTGGCAAAGCAAAGTGACTCTACCAGTAAGGTAAGTGCTGA

AACTCAGCACAAGCAGCCGTGTGACCTTGGCAAGGCTCAGGGCCATCCTTATCTAGGAATGAACACTGGTCAACAGTCTGCTCAAACTGGACATGCCCGC

CTGGCTAGTTTTTAATACTTTTCAGAGTGGGAACTTGGTGGCTGAGGCATGGGCGGCTTTCCCCAGTGGGAAGGCGGCAAGGGAGACAGACCCGAGTACG

TCCTTATAGATGCCTCAGTAAAGCTGAAGAGTCTTGGAGAAGTCTTCTGTATATACTAAGATTATATTTAGACTTTATGCTCTGGGCATGCTATCTGCCC

CTCAACTGAGCACTCTGTATTATCTTTTGTGAGAGCTCTGACTGGAACGTTTTTGCTAGTACTCTATATGACTTACCTGTATTGGGGAGTAATGGATATA

AACAAACCATTTATCAAGGTTTTTTTGGATTTTGCGTTGGCCTTCTGTGAAATATAAACCAAAAGAACTGACCATGAGCTGGCTTCAGGGTAAGTGATGC

AAGACCACAACCAGGCATGCTGGTAAACCACTGAATGTCTCACCTCCTTACATTTGTAAACAGCACCATTCTGTGACTATTTTAAAGAGGTTTCCTCAGA

ACAGTGGGAGGTGATACCAGGTCATGAACGCCACTTTGCTTTAGAAATGTGGTTTATTTCCTTGTTGTCTTGTTACTGTATACATAGTATTTTTATACCT

TAATGCTTATTCTTGATGGCATCTGTCAGGTATTTGAAGAGATCAGAAATGAGATTTTTTTTCCCCTCAAAAGTCCTTTATTTTCTGATGAGCTCATCAG

GCAGTTTTCAAAATCC
Translation
 MVKMTKSKTFQAYLPHCHRTYSCIHCRAHLANHDELISK SFQGSQGRAYLFNSV - UNI19202 - VVNVGCGPAEERVLLTGLHAVADIYCENCK

TTLGWKY - UNI22521 - EHAFESSQKYKEGKFIIELAHMIKDNGW
Transcript ENSMUST00000090198
Sequence
AGGAGGATGCCTCGCGCCCGGAGTGGGCGCCAACGGCCGGAGCGCGTCCCGGGTCACACCGGGACCGCCTGAAAACCGAGCTCGCGCCGACCGAGCCTGG

GCCGGATGGGCGCAGCGGACCGCGGAGCGGCC GTTGCACTGGCGTTCCCTTGCCCCAGTGTGTGGACAGCACCACACGCCCTCCAGACCAGCAACGGCT

CTTGCATATACTTTCCAGTGTTTTTGTCAGAGAGTCCGACAGAGCCCTAGCTCCTCCAGAGCTGGCCCAGAACCGAGTGACGAGAGCCCAGCAGACATGG

TGAAAATGACCAAGTCCAAAACTTTCCAAGCTTATCTGCCACACTGTCACCGAACTTACAGCTGCATCCACTGCAGAGCCCATCTGGCCAATCACGATGA

GCTTATCTCCAAG TCCTTTCAGGGAAGCCAGGGGCGAGCCTACCTCTTCAACTCTGT - UNI19202 - GGTGAATGTGGGCTGTGGCCCCGCTGAG

GAGAGAGTCCTTCTAACCGGGCTGCATGCAGTGGCCGACATCTACTGTGAGAACTGCAAGACCACACTCGGGTGGAAATAC GGCAGAGCACACCTTGTC

CACCACGACACTCTTCAGGCACAAAGGTCAATGCAGTCCTGGGCTCTCCCAGAGCTCTGTGCTCAGACCTTGGCCTGCCTGTCTCCAGCTTCTCTCCATA

CATAA
Translation
NRARADRAWAGWAQRTAERP PLHWRSLAPVCGQHHTPSRPATALAYTFQCFCQRVRQSPSSSRAGPEPSDESPADMVKMTKSKTFQAYLPHCHRTYSCI

HCRAHLANHDELISK SFQGSQGRAYLFNSV - UNI19202 - VVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKY GRAHLVHHDTLQAQRSM

QSWALPELCAQTLACLSPASLHT
Transcript ENSMUST00000023458
Sequence
CTCGCGCCCGGAGTGGGCGCCAACGGCCGGAGCGCGTCCCGGGTCACACCGGGACCGCCTGAAAACCGAGCTCGCGCCGACCGAGCCTGGGCCGGATGGG

CGC AACTTCCCCACTGGAGG TCCTTTCAGGGAAGCCAGGGGCGAGCCTACCTCTTCAACTCTGT - UNI19202 - GGTGAATGTGGGCTGTGGCC

CCGCTGAGGAGAGAGTCCTTCTAACCGGGCTGCATGCAGTGGCCGACATCTACTGTGAGAACTGCAAGACCACACTCGGGTGGAAATAC - UNI22521

 - GAACATGCCTTTGAGAGCAGTCAGAAATACAAGGAAGGAAAATTTATTATTGAACTTGCCCACATGATCAAAGACAACGGCTGGTAAAGTGAAGCGG

TCCACTCCTGTTTGAATCCTATTTTATGAAAGCTGAGTGTACAGAAGACCTAGCTTCTTGGTGACAATGCTTCTTGAACTTAACCTCACAGGCCAGCCCA

GTCTCAACACTTGAAGGTGTCTCTCTAGGCTATCCACTTGGTAAGGTGCCCATTTGAATCCCTGTCGTGTACAATGCGTTTTTGGAAGTCTGAGTTCTTT

TTCTAACATCTTAAGTTCTAGAGAAAGAATTGACCAGCTGGTGACTCACCTGCCTAGTGAATACTTTCTTTTACCCTACGCCTGCAATGCCTGGCTGTGT

TCTCACCAAGCCCAAGTCCCTAAAAGCAGAGAAGCAAGGTCTCCTCACAAGCAAAGGCATAGTTACCAGAAGTAAAGCATGTCTCCAAAAACTGAAACCA

GCCACTGGTAACATGGAAGAGAAGCTAGGAAGCAAGCATTCAGTGTACATCTTAAGCAAATAGGGAGGTTCCTGATGTAGAAGGCGAGTGACTTACTGGT

GGCTGAACGCTCTGTCCCAGGGCTACCCAAGTCTGCCACTGAGCTGACTCCCTTGGTGCTGCGGCAGCACAGCGGCTCAGAATGTAGGGCTGGTCCCTGC

CACAGAGCAACAGGCTGGGTTTCACTTTATACCCTGGATGTACTTGAAATAGTTATGCATACAGAGGCCAGAGCCAGTACGGGAAACTGCAAAACATGAG

AGTTTTCCAAGGTAAAGGAAGAGTTAGCTTAGTATGGGAGCTACCTTTTCTGCCTGGAATCACCTCATGACCTGACAAGGGAGGATCTGGGCCATCCCCC

AAGCCCAGGCTCTCAGATTTTAAGTCACAACACATCATACTCTATAAGGAGTGGCCAATTTGCAGAGAGGATGGAGGCCAGAACCATTCCCAGATAAGTT

TCATTGTTTTGTACCCTCCCCAGGGCAGAAGGGCAGGCAGTAGGCCTGTGAAGGCTGAGAGCCCTTGAGCTGCAAAGGCAGCATTACAGGAAAGCGCTTA

GCACCGGCTGCTCTAGAGCTGCCTGGGTGTGGTAGTCAAAAAGCAGTTTCTATCTAGACCTTTGGGCTCCAGCCCCAGACCTGCTAAACCCACATCCTCT

GGCCAGCACAGGCACTCGCTACTCCTCTTCACTTCAAAACCTACATTTTGGTGCCATTTCTTTGCCCAAGATTGGAAGGCTGGTAATACAGGAAATGCCT

GCGCAATGCTGGTCCTAGCCCAAGCTGCTTTTTCCCCAGCTACTTCCAGTTTCCCTCTAGACTAAGGCTGGCAAAGCAAAGTGACTCTACCAGTAAGGTA

AGTGCTGAAACTCAGCACAAGCAGCCGTGTGACCTTGGCAAGGCTCAGGGCCATCCTTATCTAGGAATGAACACTGGTCAACAGTCTGCTCAAACTGGAC

ATGCCCGCCTGGCTAGTTTTTAATACTTTTCAGAGTGGGAACTTGGTGGCTGAGGCATGGGCGGCTTTCCCCAGTGGGAAGGCGGCAAGGGAGACAGACC

CGAGTACGTCCTTATAGATGCCTCAGTAAAGCTGAAGAGTCTTGGAGAAGTCTTCTGTATATACTAAGATTATATTTAGACTTTATGCTCTGGGCATGCT

ATCTGCCCCTCAACTGAGCACTCTGTATTATCTTTTGTGAGAGCTCTGACTGGAACGTTTTTGCTAGTACTCTATATGACTTACCTGTATTGGGGAGTAA

TGGATATAAACAAACCATTTATCAAGGTTTTTTTGGATTTTGCGTTGGCCTTCTGTGAAATATAAACCAAAAGAACTGACCATGAGCTGGCTTCAGGGTA

AGTGATGCAAGACCACAACCAGGCATGCTGGTAAACCACTGAATGTCTCACCTCCTTACATTTGTAAACAGCACCATTCTGTGACTATTTTAAAGAGGTT

TCCTCAGAACAGTGGGAGGTGATACCAGGTCATGAACGCCACTTTGCTTTAGAAATGTGGTTTATTTCCTTGTTGTCTTGTTACTGTATACATAGTATTT

TTATACCTTAATGCTTATTCTTGATGGCATCTGTCAGGTATTTGAAGAGATCAGAAATGAGATTTTTTTTCCCCTCAAAAGTCCTTTATTTTCTGATGAG

CTCATCAGGCAGTTTTCAAAATCC
Translation
LAPGVGANGRSASRVTPGPPENRARADRAWAGWAQ QLPHWR SFQGSQGRAYLFNSV - UNI19202 - VVNVGCGPAEERVLLTGLHAVADIYCEN

CKTTLGWKY - UNI22521 - EHAFESSQKYKEGKFIIELAHMIKDNGW

For any suggestions or comments, please send an email to unitrap@crg.es