Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022791 (Tnk2)
Chromosomal location
Chr 16: 32644729 - 32683579 (+)
Description
tyrosine kinase, non-receptor, 2 Gene [Source:MGI (curated);Acc:Tnk2-002]
RefSeq_dna
NM_016788 
RefSeq_peptide
NP_001103617.1 NP_058068.2 
UniGene
Mm.251115 
MGI
MGI:1858308 
Uniprot/SWISSPROT
O54967 
Human Ortholog
ENSG00000061938 (TNK2)
Omim not available
UniTrap UNI36921
Vector Insertion
Chr 16: 32645195 - 32663824
Public Clones (sanger) 5SD165F10 (ggtc) 3SD155D11 (ggtc) 5SE128H06 (ggtc) 3SD165F10 (ggtc)
5SD165H09 (ggtc) 5SD155D11 (ggtc) 3SD076D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21339
Vector Insertion
Chr 16: 32663824 - 32664006
Public Clones not available
Private Clones OST333943 (lexicon) OST187561 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25326
Vector Insertion
Chr 16: 32673367 - 32675607
Public Clones (cmhd) CMHD-GT_421D7-3 (cmhd)
Private Clones OST187772 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115120
Sequence
TCCGCCCCAGGCTCCTGCTGGCTTCAGCTGCTAATACTGCCACAGCGGATGGGTCAACTTCTAGACTGCCTTCTTCTGAGGTGCCAGCTTTTACTCGGTC

CCTAGAACTGCTCAGGAGGTGGGAG - UNI25326 - GGCTGAGAACTACTGGTGGCGTGGGCAGAATACGCGGACCCTGTGTGTAGGACCCTTCCCT

CGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAGCCTCTACAGAATAGCTTCATTCACACAGGACATGGTGACAGTGACCCCC

GCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAACCCCATGGACCCTCCTGACCTGCTGAGTGTGGAACTGAGCACCTCCCGAC

CCACCCAGCACCTAGGACGGGTGAAAA AGCCAACATACGACCCTGTGAGTGAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGA

AGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAAGCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGA

CTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGGCCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCA

CAGAGCCCCACACGGGCACTGCCACGACCTTTACACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGG

CCCAGGATGAGGATGACTTTGAGGTCTGCTCCATCAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTT

TGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTGGAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAG

ATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGCAGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGG

TGCCACCCCGGGTACCTATTCCCCCTCGGCCCACGCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACC

TGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCTCTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCAT

CGGCTCTCTAGCTCACCTGGAAAGACCATGCCCACCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCAC

GGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGATGGCAGGAAGGTCAGCAGCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTA

TCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAAGAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCC

ACTGCCACCGTCAGACCTATGCCTCAGGCCGCCCCAGACCCAAAGGCCAACTTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGG

CCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGGGGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGGTCCAGATG CTGCAGGCCATGGTGCATGGGG

TGACCACAGAGGAGTGCCAGGCGGCCCTGCAGAGCCACAGCTGGAGTGTTCAGAGGGCTGCCCAGTATCTGAAG GTGGAGCAGCTCTTTGGGCTGGGTC

TTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGAGATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCA

CAA ACGCTGATGGTTGACTGGAGAGCAGTGGTCTGCCCTAAAAGAACCTCTTGAACCTGTCTGTGGGACAAGGGTGGGGGAGCTGCCCTGCCTCAGGCC

CGAAGGACCCACAACTGCCTGCGGCTCCCAGGGGACAGTGAGACCCAGGCAGCAGGAGGCTGGGAGCCTCACCTTGCCCACCTCGCTCACCCACCCAGCG

CTGTTCTGCACACCTTGGTTCAGCCCTCAGTGCCCCAAGAGGTGGGACGTTCCCAGCCTTGTGAAGGCAAGACAGGAAGCTGCCTGGCAGGCTCTGTGTG

GCCTGCCTCTGGCTCCAGATCAAGGCTGGGCTGGTGGCTAGAGTGTGCCCCAGGCTTTCCTCTGGGGGATTAGACTGACAGGAAGCCAGGCTTGACATGG

ACAAGAAGGATGTGTTGGCCACACAGCAGGGCGAGCCAGCAACCAACAGGCCCTCCTCAGGGCTAGGCCCCTTCCCAGGGAACCCCTGTAGGAGTGTGGA

GTGTTGGACAGAATGTGACCTGTAGCTTCACTGTGAACTTGTGGGCTTGGCTGGTCTTAGGAACTTGTACCTATAAACAGCCTGAAGTGGCTCAGAAACA

GAAAAGGTGCCAGGATCTTCTCTGGCAGGGACCAGGGCCCAAGGCCCCGGATGTGGAAGGAGACCCCAGTGGCACCAGTACTTTCCTGTTTGACCTGTTC

CTCCCCTGTTGCTATCTGATGTGTTCCCATCAGCCTCTGTTGCCAAAGTCGTGGCCCCAGCTATGGATATCTGCTTCTTCCAGAGAAATAAAGCTTGTTT

CTATTTTATGTTA
Translation
 - UNI25326 -  MDPPDLLSVELSTSRPTQHLGRVKK KPTYDPVSEDPDPLSSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDF

GEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEVCSINSTLVGAGLPAGPSQGETNYAFV

PEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEETSRWPGPA

SPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQ

RFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQRGCPGDGQEAARPADKVQM LQAMVHGV

TTEECQAALQSHSWSVQRAAQYLK VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR
Transcript ENSMUST00000115121
Sequence
GGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAAGAGTAATGCAGGAAGATG

TAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATCCTTTCTGCTACCTCAAGT

CTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCATGCAGCCGGAGGAGGGAAC

GGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGCCTATCTCATTTTGAATAT

GTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGTGAAGAGGAGGAAGGCCAT

GTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAGCACCTTCCGGAAGCCCTC

CCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTGGAGAAGCTGGGGGATGGC

TCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCTGACGTGCTGAGCCAGCCA

GAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGGTGCTCACACTACCCATGA

AGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGCTGAGTCGCTACGCTGTGC

AGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTACCCGGGACCTGGTCAAGAT

TGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCCTG GTGTGCCCCTGAGAG

CCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTC

AATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTACAATGTCATGGTCCAGTGC

TGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGGGCTCTTCAGGACTTTGAG

GAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTACTGGTGGCGTGGGCAGAA

TACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAGCCTCTACAGAATAGCTTC

ATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAACCCCATGGACCCTCCTGAC

CTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA AGCCAACATACGACCCTGTGAGTGAGGACCCAGACCCCCTG

TCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAAGCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACC

GCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGGCCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGA

TGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCCACGACCTTTACACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCG

CTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGGTCTGCTCCATCAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTG

GGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTGGAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGG

CAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGCAGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCC

CCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCCCCTCGGCCCACGCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGG

GTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCTCTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCT

AGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAAGACCATGCCCACCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCC

ACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGATGGCAGGAAGGTCAGCAGCACTCATTACTACCTGC

TGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAAGAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCC

CCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCCTCAGGCCGCCCCAGACCCAAAGGCCAACTTCTCCACCAATAACAGC

AACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGGGGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGG

TCCAGATG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGAGATGTTCGACTGGAACCTAGAGCAAGCCGGCT

GTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGC
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKK KPTYDPVSEDPDPLSSDFKRLGLRKPALPRG

LWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF

EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPI

PPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCIL

PIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQ

RGCPGDGQEAARPADKVQM VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR
Transcript ENSMUST00000115122
Sequence
GGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAAGAGTAATGCAGGAAGATG

TAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATCCTTTCTGCTACCTCAAGT

CTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCATGCAGCCGGAGGAGGGAAC

GGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGCCTATCTCATTTTGAATAT

GTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGTGAAGAGGAGGAAGGCCAT

GTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAGCACCTTCCGGAAGCCCTC

CCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTGGAGAAGCTGGGGGATGGC

TCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCTGACGTGCTGAGCCAGCCA

GAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGGTGCTCACACTACCCATGA

AGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGCTGAGTCGCTACGCTGTGC

AGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTACCCGGGACCTGGTCAAGAT

TGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCCTG GTGTGCCCCTGAGAG

CCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTC

AATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTACAATGTCATGGTCCAGTGC

TGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGGGCTCTTCAGGACTTTGAG

GAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTACTGGTGGCGTGGGCAGAA

TACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAGCCTCTACAGAATAGCTTC

ATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAACCCCATGGACCCTCCTGAC

CTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA AGCCAACATACGACCCTGTGAGTGAGGACCCAGACCCCCTG

TCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAAGCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACC

GCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGGCCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGA

TGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCCACGACCTTTACACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCG

CTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGGTCTGCTCCATCAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTG

GGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTGGAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGG

CAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGCAGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCC

CCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCCCCTCGGCCCACGCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGG

GTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCTCTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCT

AGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAAGACCATGCCCACCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCC

ACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGATGGCAGGAAGGTCAGCAGCACTCATTACTACCTGC

TGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAAGAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCC

CCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCCTCAGGCCGCCCCAGACCCAAAGGCCAACTTCTCCACCAATAACAGC

AACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGGGGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGG

TCCAGATG CTGCAGGCCATGGTGCATGGGGTGACCACAGAGGAGTGCCAGGCGGCCCTGCAGAGCCACAGCTGGAGTGTTCAGAGGGCTGCCCAGTATC

TGAAG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGAGATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTC

ACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGC
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKK KPTYDPVSEDPDPLSSDFKRLGLRKPALPRG

LWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF

EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPI

PPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCIL

PIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQ

RGCPGDGQEAARPADKVQM LQAMVHGVTTEECQAALQSHSWSVQRAAQYLK VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR
Transcript ENSMUST00000023480
Sequence
GGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAAGAGTAATGCAGGAAGATG

TAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATCCTTTCTGCTACCTCAAGT

CTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCATGCAGCCGGAGGAGGGAAC

GGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGCCTATCTCATTTTGAATAT

GTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGTGAAGAGGAGGAAGGCCAT

GTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAGCACCTTCCGGAAGCCCTC

CCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTGGAGAAGCTGGGGGATGGC

TCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCTGACGTGCTGAGCCAGCCA

GAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGGTGCTCACACTACCCATGA

AGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGCTGAGTCGCTACGCTGTGC

AGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTACCCGGGACCTGGTCAAGAT

TGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCCTG GTGTGCCCCTGAGAG

CCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTC

AATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTACAATGTCATGGTCCAGTGC

TGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGGGCTCTTCAGGACTTTGAG

GAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTACTGGTGGCGTGGGCAGAA

TACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAGCCTCTACAGAATAGCTTC

ATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAACCCCATGGACCCTCCTGAC

CTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA GGGAGCCTCCACCTCGCCCACCTCAGCCTGCCATCTTCACT

CAGA AGCCAACATACGACCCTGTGAGTGAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTG

TGGCTGGCAAAGCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCC

CAACCCCTCGGCCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCC

ACGACCTTTACACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAG

GTCTGCTCCATCAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGC

CCCCTGCCCTGGAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGA

GTGTATGCGGCAGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCC

CCTCGGCCCACGCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTC

CCCGGGAACCTCTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAA

GACCATGCCCACCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCC

ATTGTCCGCGATGGCAGGAAGGTCAGCAGCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCC

AGAGCCCGGAAGAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCC

TCAGGCCGCCCCAGACCCAAAGGCCAACTTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGG

GGCTGCCCAGGGGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGGTCCAGATG CTGCAGGCCATGGTGCATGGGGTGACCACAGAGGAGTGCCAGGCG

GCCCTGCAGAGCCACAGCTGGAGTGTTCAGAGGGCTGCCCAGTATCTGAAG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCAC

AAGGTCCTAGAGATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGC
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKR REPPPRPPQPAIFTQK KPTYDPVSEDPDPL

SSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARP

LPPPPAYDDVAQDEDDFEVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPS

PTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYA

TPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNS

NPGARPPSLRATARLPQRGCPGDGQEAARPADKVQM LQAMVHGVTTEECQAALQSHSWSVQRAAQYLK VEQLFGLGLRPRVECHKVLEMFDWNLEQAG

CHLLGSCGPAHHK KR
Transcript ENSMUST00000115123
Sequence
GTCCTCAGGGGGAGAGGGATTCCAAGAGGGACACAGGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAG

GGTTGCTCTAGTGCCAAGAGTAATGCAGGAAGATGTAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGG

CACTGGCCTGCAAGATCCTTTCTGCTACCTCAAGTCTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGG

CTGGGGAGCAGCAGCATGCAGCCGGAGGAGGGAACGGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATG

ACCTCAACATTACCCGCCTATCTCATTTTGAATATGTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGG

CGGCTGTGGGAGGCCGTGAAGAGGAGGAAGGCCATGTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCT

TCCCAGCACTCTCAGAGCACCTTCCGGAAGCCCTCCCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGA

AAGACCTACGCCTGCTGGAGAAGCTGGGGGATGGCTCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCG

TCAAGTGCCTGAAGCCTGACGTGCTGAGCCAGCCAGAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCAT

TCGCTTGTATGGTGTGGTGCTCACACTACCCATGAAGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCA

TTTCCTCTTGGGGACGCTGAGTCGCTACGCTGTGCAGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGA

AACCTGCTTTTGGCTACCCGGGACCTGGTCAAGATTGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACC

GCAAGGTGCCCTTTGCCTG GTGTGCCCCTGAGAGCCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGA

TGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTCAATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACT

GCCCTCAAGACATCTACAATGTCATGGTCCAGTGCTGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTC

AGCCCACTGACATGCGGGCTCTTCAGGACTTTGAGGAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI253

26 - GGCTGAGAACTACTGGTGGCGTGGGCAGAATACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAG

CCCAGGACATCAGCCAGCCTCTACAGAATAGCTTCATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA

 ACTGTACCTGGGAAACCCCATGGACCCTCCTGACCTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA AGCCAA

CATACGACCCTGTGAGTGAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAA

GCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGG

CCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCCACGACCTTTAC

ACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGGTCTGCTCCAT

CAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTG

GAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGC

AGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCCCCTCGGCCCAC

GCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCT

CTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAAGACCATGCCCA

CCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGA

TGGCAGGAAGGTCAGCAGCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAA

GAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCCTCAGGCCGCCC

CAGACCCAAAGGCCAACTTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGG

GGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGGTCCAGATG CTGCAGGCCATGGTGCATGGGGTGACCACAGAGGAGTGCCAGGCGGCCCTGCAGAG

CCACAGCTGGAGTGTTCAGAGGGCTGCCCAGTATCTGAAG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGA

GATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGCTGATGGTTGACTGGAGAGCAGTGGTC

TGCCCTAAAAGAACCTCTTGAACCTGTCTGTGGGACAAGGGTGGGGGAGCTGCCCTGCCTCAGGCCCGAAGGACCCACAACTGCCTGCGGCTCCCAGGGG

ACAGTGAGACCCAGGCAGCAGGAGGCTGGGAGCCTCACCTTGCCCACCTCGCTCACCCACCCAGCGCTGTTCTGCACACCTTGGTTCAGCCCTCAGTGCC

CCAAGAGGTGGGACGTTCCCAGCCTTGTGAAGGCAAGACAGGAAGCTGCCTGGCAGGCTCTGTGTGGCCTGCCTCTGGCTCCAGATCAAGGCTGGGCTGG

TGGCTAGAGTGTGCCCCAGGCTTTCCTCTGGGGGATTAGACTGACAGGAAGCCAGGCTTGACATGGACAAGAAGGATGTGTTGGCCACACAGCAGGGCGA

GCCAGCAACCAACAGGCCCTCCTCAGGGCTAGGCCCCTTCCCAGGGAACCCCTGTAGGAGTGTGGAGTGTTGGACAGAATGTGACCTGTAGCTTCACTGT

GAACTTGTGGGCTTGGCTGGTCTTAGGAACTTGTACCTATAAACAGCCTGAAGTGGCTCAGAAACAGAAAAGGTGCCAGGATCTTCTCTGGCAGGGACCA

GGGCCCAAGGCCCCGGATGTGGAAGGAGACCCCAGTGGCACCAGTACTTTCCTGTTTGACCTGTTCCTCCCCTGTTGCTATCTGATGTGTTCCCATCAGC

CTCTGTTGCCAAAGTCGTGGCCCCAGCTATGGATATCTGCTTCTTCCAGAGAAATAAAGCTTGTTTCTATTTTATGTT
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKK KPTYDPVSEDPDPLSSDFKRLGLRKPALPRG

LWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF

EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPI

PPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCIL

PIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQ

RGCPGDGQEAARPADKVQM LQAMVHGVTTEECQAALQSHSWSVQRAAQYLK VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR
Transcript ENSMUST00000115124
Sequence
CAGACTCGAGCTGCTGGGGAGAGCCAGGCCTGTAGGGCCCCGAGGGCCTGAAGGAGAGGGGCGCCTGGGGGTGCAGGAAGCAAATTGGCTGCCCGGGGTG

CAAGAGGGCCAGGTAGTGTGGGCTGTTCAGGAGACGTATCTGAACGGTAAAGGGTCCTCAGGGGGAGAGGGATTCCAAGAGGGACACAGGACCCGCAGGC

GCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAAGAGTAATGCAGGAAGATGTAGGGGATTGGG

GAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATCCTTTCTGCTACCTCAAGTCTGAGCATCCTC

GAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCATGCAGCCGGAGGAGGGAACGGGCTGGCTGTT

GGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGCCTATCTCATTTTGAATATGTCAAAAATGAA

GACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGTGAAGAGGAGGAAGGCCATGTGCAAACGCAA

GTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAGCACCTTCCGGAAGCCCTCCCCCACCCCAGG

GAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTGGAGAAGCTGGGGGATGGCTCCTTTGGCGTG

GTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCTGACGTGCTGAGCCAGCCAGAGGCCATGGAC

GACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGGTGCTCACACTACCCATGAAGATG GTGACA

GAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGCTGAGTCGCTACGCTGTGCAGGTGGCTGAGG

GTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTACCCGGGACCTGGTCAAGATTGGGGACTTCGG

ACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCCTG GTGTGCCCCTGAGAGCCTGAAGACACG

GACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTCAATGGCAGCCAG

 ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTACAATGTCATGGTCCAGTGCTGGGCCCACAAG

CCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGGGCTCTTCAGGACTTTGAGGAGCCAGATAAA

CTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTACTGGTGGCGTGGGCAGAATACGCGGACCCT

GTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAGCCTCTACAGAATAGCTTCATTCACACAGGA

CATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAACCCCATGGACCCTCCTGACCTGCTGAGTGTG

GAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA GGGAGCCTCCACCTCGCCCACCTCAGCCTGCCATCTTCACTCAGA AGCCAAC

ATACGACCCTGTGAGTGAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAAG

CCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGGC

CCTGTGCACCCTCCTTGGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCCACGACCTTTACA

CCCCACCCCTGTGGTAGACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGGTCTGCTCCATC

AACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTGG

AGGATAACCTGTTCCTTCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGCA

GCTACAGGTCCCCACTGGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCCCCTCGGCCCACG

CGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCTC

TGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAAGACCATGCCCAC

CACTCAAAGCTTTGCCTCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGAT

GGCAGGAAGGTCAGCAGCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAAG

AGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCCTCAGGCCGCCCC

AGACCCAAAGGCCAACTTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGGG

GACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGGTCCAGATG CTGCAGGCCATGGTGCATGGGGTGACCACAGAGGAGTGCCAGGCGGCCCTGCAGAGC

CACAGCTGGAGTGTTCAGAGGGCTGCCCAGTATCTGAAG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGAG

ATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGCTGATGGTTGACTGGAGAGCAGTGGTCT

GCCCTAAAAGAACCTCTTGAACCTGTCTGTGGGACAAGGGTGGGGGAGCTGCCCTGCCTCAGGCCCGAAGGACCCACAACTGCCTGCGGCTCCCAGGGGA

CAGTGAGACCCAGGCAGCAGGAGGCTGGGAGCCTCACCTTGCCCACCTCGCTCACCCACCCAGCGCTGTTCTGCACACCTTGGTTCAGCCCTCAGTGCCC

CAAGAGGTGGGACGTTCCCAGCCTTGTGAAGGCAAGACAGGAAGCTGCCTGGCAGGCTCTGTGTGGCCTGCCTCTGGCTCCAGATCAAGGCTGGGCTGGT

GGCTAGAGTGTGCCCCAGGCTTTCCTCTGGGGGATTAGACTGACAGGAAGCCAGGCTTGACATGGACAAGAAGGATGTGTTGGCCACACAGCAGGGCGAG

CCAGCAACCAACAGGCCCTCCTCAGGGCTAGGCCCCTTCCCAGGGAACCCCTGTAGGAGTGTGGAGTGTTGGACAGAATGTGACCTGTAGCTTCACTGTG

AACTTGTGGGCTTGGCTGGTCTTAGGAACTTGTACCTATAAACAGCCTGAAGTGGCTCAGAAACAGAAAAGGTGCCAGGATCTTCTCTGGCAGGGACCAG

GGCCCAAGGCCCCGGATGTGGAAGGAGACCCCAGTGGCACCAGTACTTTCCTGTTTGACCTGTTCCTCCCCTGTTGCTATCTGATGTGTTCCCATCAGCC

TCTGTTGCCAAAGTCGTGGCCCCAGCTATGGATATCTGCTTCTTCCAGAGAAATAAAGCTTGTTTCTATTTTATGTTA
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKR REPPPRPPQPAIFTQK KPTYDPVSEDPDPL

SSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARP

LPPPPAYDDVAQDEDDFEVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPS

PTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYA

TPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNS

NPGARPPSLRATARLPQRGCPGDGQEAARPADKVQM LQAMVHGVTTEECQAALQSHSWSVQRAAQYLK VEQLFGLGLRPRVECHKVLEMFDWNLEQAG

CHLLGSCGPAHHK KR
Transcript ENSMUST00000115125
Sequence
GGTCCTTGGAGCATCCCTAGCGAGTGGGGACAGACTCGAGCTGCTGGGGAGAGCCAGGCCTGTAGGGCCCCGAGGGCCTGAAGGAGAGGGGCGCCTGGGG

GTGCAGGAAGCAAATTGGCTGCCCGGGGTGCAAGAGGGCCAGGTAGTGTGGGCTGTTCAGGAGACGTATCTGAACGGTAAAGGGTCCTCAGGGGGAGAGG

GATTCCAAGAGGGACACAGGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAA

GAGTAATGCAGGAAGATGTAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATC

CTTTCTGCTACCTCAAGTCTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCAT

GCAGCCGGAGGAGGGAACGGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGC

CTATCTCATTTTGAATATGTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGT

GAAGAGGAGGAAGGCCATGTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAG

CACCTTCCGGAAGCCCTCCCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTG

GAGAAGCTGGGGGATGGCTCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCT

GACGTGCTGAGCCAGCCAGAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGG

TGCTCACACTACCCATGAAGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGC

TGAGTCGCTACGCTGTGCAGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTAC

CCGGGACCTGGTCAAGATTGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCC

TG GTGTGCCCCTGAGAGCCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAG

GAGCCCTGGATTGGCCTCAATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTAC

AATGTCATGGTCCAGTGCTGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGG

GCTCTTCAGGACTTTGAGGAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTA

CTGGTGGCGTGGGCAGAATACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAG

CCTCTACAGAATAGCTTCATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAAC

CCCATGGACCCTCCTGACCTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA AGCCAACATACGACCCTGTGAGT

GAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCAGCCCTGCCTCGAGGGCTGTGGCTGGCAAAGCCCTCAGCCCGAGTGC

CAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCGGTGAGGAGCCTGTGGTCCCAACCCCTCGGCCCTGTGCACCCTCCTT

GGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCACAGAGCCCCACACGGGCACTGCCACGACCTTTACACCCCACCCCTGTGGTA

GACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGGTCTGCTCCATCAACAGCACGCTAGTAG

GTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTACCTGAGCAGGCGCAGATGCCCCCTGCCCTGGAGGATAACCTGTTCCT

TCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTTCCAGGCACTGCAGCAGGAGTGTATGCGGCAGCTACAGGTCCCCACT

GGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCACCCCGGGTACCTATTCCCCCTCGGCCCACGCGTCCACGTGTGGAGC

TATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCTCGCCCCCCCGAGTGCCTCCCCGGGAACCTCTGTCTCCTCAAGGTTC

AAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCTCTCTAGCTCACCTGGAAAGACCATGCCCACCACTCAAAGCTTTGCC

TCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCAGGCCCCTGCATCCTGCCCATTGTCCGCGATGGCAGGAAGGTCAGCA

GCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGCGCTTCCTGCGGGAGGCCCAGAGCCCGGAAGAGCCGGCCGCCCTGCC

TGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGCCACCGTCAGACCTATGCCTCAGGCCGCCCCAGACCCAAAGGCCAAC

TTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGGCCACGGCTCGGCTGCCACAGAGGGGCTGCCCAGGGGACGGGCAAGAGGCTG

CTCGGCCAGCAGACAAGGTCCAGATG GTGGAGCAGCTCTTTGGGCTGGGTCTTCGGCCACGGGTGGAGTGCCACAAGGTCCTAGAGATGTTCGACTGGA

ACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACAA ACGCTGATGGTTGACTGGAGAGCAGTGGTCTGCCCTAAAAGAAC

CTCTTGAACCTGTCTGTGGGACAAGGGTGGGGGAGCTGCCCTGCCTCAGGCCCGAAGGACCCACAACTGCCTGCGGCTCCCAGGGGACAGTGAGACCCAG

GCAGCAGGAGGCTGGGAGCCTCACCTTGCCCACCTCGCTCACCCACCCAGCGCTGTTCTGCACACCTTGGTTCAGCCCTCAGTGCCCCAAGAGGTGGGAC

GTTCCCAGCCTTGTGAAGGCAAGACAGGAAGCTGCCTGGCAGGCTCTGTGTGGCCTGCCTCTGGCTCCAGATCAAGGCTGGGCTGGTGGCTAGAGTGTGC

CCCAGGCTTTCCTCTGGGGGATTAGACTGACAGGAAGCCAGGCTTGACATGGACAAGAAGGATGTGTTGGCCACACAGCAGGGCGAGCCAGCAACCAACA

GGCCCTCCTCAGGGCTAGGCCCCTTCCCAGGGAACCCCTGTAGGAGTGTGGAGTGTTGGACAGAATGTGACCTGTAGCTTCACTGTGAACTTGTGGGCTT

GGCTGGTCTTAGGAACTTGTACCTATAAACAGCCTGAAGTGGCTCAGAAACAGAAAAGGTGCCAGGATCTTCTCTGGCAGGGACCAGGGCCCAAGGCCCC

GGATGTGGAAGGAGACCCCAGTGGCACCAGTACTTTCCTGTTTGACCTGTTCCTCCCCTGTTGCTATCTGATGTGTTCCCATCAGCCTCTGTTGCCAAAG

TCGTGGCCCCAGCTATGGATATCTGCTTCTTCCAGAGAAATAAAGCTTGTTTCTATTTTATGTTA
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKK KPTYDPVSEDPDPLSSDFKRLGLRKPALPRG

LWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDF

EVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPSPTPGGDDKPQVPPRVPI

PPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCIL

PIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPSLRATARLPQ

RGCPGDGQEAARPADKVQM VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR
Transcript ENSMUST00000115126
Sequence
GGTCCTTGGAGCATCCCTAGCGAGTGGGGACAGACTCGAGCTGCTGGGGAGAGCCAGGCCTGTAGGGCCCCGAGGGCCTGAAGGAGAGGGGCGCCTGGGG

GTGCAGGAAGCAAATTGGCTGCCCGGGGTGCAAGAGGGCCAGGTAGTGTGGGCTGTTCAGGAGACGTATCTGAACGGTAAAGGGTCCTCAGGGGGAGAGG

GATTCCAAGAGGGACACAGGACCCGCAGGCGCAGACGGCGAAGGAGGTGGTAATCGGCAAGCTGCCTTCCTTGCTGGCATCAGGGTTGCTCTAGTGCCAA

GAGTAATGCAGGAAGATGTAGGGGATTGGGGAGCAGAAGAGCGCTGTGAACCTGACCTTTGGAAGATATTGCTGGAGGGTAGGCACTGGCCTGCAAGATC

CTTTCTGCTACCTCAAGTCTGAGCATCCTCGAAGCAGTGTCTGCCTGGGGACAGCTGGAAACTCAG - UNI21339 - AGGCTGGGGAGCAGCAGCAT

GCAGCCGGAGGAGGGAACGGGCTGGCTGTTGGAGCTGCTGTCCGAGGTGCAGCTACAACAGTATTTCCTGAGGCTTCGAGATGACCTCAACATTACCCGC

CTATCTCATTTTGAATATGTCAAAAATGAAGACCTGGAAAAGATTGGCATGGGCCGGCCTG - UNI21339 - GCCAGAGGCGGCTGTGGGAGGCCGT

GAAGAGGAGGAAGGCCATGTGCAAACGCAAGTCATGGATGAGCAAG GTGTTCAGTGGAAAGCGGTTGGAGGCCGAGTTCCCTTCCCAGCACTCTCAGAG

CACCTTCCGGAAGCCCTCCCCCACCCCAGGGAGCCTGCCAGGGGAGGGGACCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAAGACCTACGCCTGCTG

GAGAAGCTGGGGGATGGCTCCTTTGGCGTGGTGCGCAGGGGTGAATGGGACGCCCCCGCAGGGAAGACG GTGAGTGTGGCCGTCAAGTGCCTGAAGCCT

GACGTGCTGAGCCAGCCAGAGGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCATTCACTAGACCACCGAAACCTCATTCGCTTGTATGGTGTGG

TGCTCACACTACCCATGAAGATG GTGACAGAGCTGGCACCTCTGGGATCTTTGTTGGACCGCCTACGTAAACACCAAGGTCATTTCCTCTTGGGGACGC

TGAGTCGCTACGCTGTGCAGGTGGCTGAGGGTATGGCCTACCTGGAGTCCAAGCGCTTCATTCACCGGGATCTGGCTGCTCGAAACCTGCTTTTGGCTAC

CCGGGACCTGGTCAAGATTGGGGACTTCGGACTGATGCGAGCTCTGCCCCAGAATGATGACCACTATGTCATGCAAGAACACCGCAAGGTGCCCTTTGCC

TG GTGTGCCCCTGAGAGCCTGAAGACACGGACTTTCTCCCATGCCAGTGACACCTGGATGTTTGGGGTCACACTGTGGGAGATGTTCACCTATGGCCAG

GAGCCCTGGATTGGCCTCAATGGCAGCCAG ATCCTGCATAAGATCGACAAGGAAGGGGAGCGCCTGCCCCGGCCGGAGGACTGCCCTCAAGACATCTAC

AATGTCATGGTCCAGTGCTGGGCCCACAAGCCAGAGGACAGACCCACATTTGTGGCTCTTCGGGACTTCCTGCTGGAG GCTCAGCCCACTGACATGCGG

GCTCTTCAGGACTTTGAGGAGCCAGATAAACTGCACATCCAGATGAATGACGTCATCACTGTCATCGAGGGAAG - UNI25326 - GGCTGAGAACTA

CTGGTGGCGTGGGCAGAATACGCGGACCCTGTGTGTAGGACCCTTCCCTCGAAATGTCGTGACCTCCGTGGCTGGCCTGTCAGCCCAGGACATCAGCCAG

CCTCTACAGAATAGCTTCATTCACACAGGACATGGTGACAGTGACCCCCGCCACTGCTGGGGGTTCCCTGACAGGATCGATGA ACTGTACCTGGGAAAC

CCCATGGACCCTCCTGACCTGCTGAGTGTGGAACTGAGCACCTCCCGACCCACCCAGCACCTAGGACGGGTGAAAA GGGAGCCTCCACCTCGCCCACCT

CAGCCTGCCATCTTCACTCAGA AGCCAACATACGACCCTGTGAGTGAGGACCCAGACCCCCTGTCCAGCGACTTCAAGAGGCTTGGCCTGAGGAAGCCA

GCCCTGCCTCGAGGGCTGTGGCTGGCAAAGCCCTCAGCCCGAGTGCCAGGCACCAAGGCAGACCGCAGCAGTGGGGGTGAGGTCACACTCATCGACTTCG

GTGAGGAGCCTGTGGTCCCAACCCCTCGGCCCTGTGCACCCTCCTTGGCACAGTTGGCCATGGATGCCTGCTCCTTGCTGGACAAGACACCACCACAGAG

CCCCACACGGGCACTGCCACGACCTTTACACCCCACCCCTGTGGTAGACTGGGACGCGCGTCCGCTGCCCCCGCCCCCTGCCTATGACGACGTGGCCCAG

GATGAGGATGACTTTGAGGTCTGCTCCATCAACAGCACGCTAGTAGGTGCAGGCCTCCCTGCTGGGCCTAGCCAAGGCGAGACCAATTACGCCTTTGTAC

CTGAGCAGGCGCAGATGCCCCCTGCCCTGGAGGATAACCTGTTCCTTCCACCCCAGGGCGGAGGCAAGCCGCCCAGCTCAGTGCAGACTGCAGAGATTTT

CCAGGCACTGCAGCAGGAGTGTATGCGGCAGCTACAGGTCCCCACTGGCCAGCTGACCCCCTCCCCGACCCCAGGAGGTGATGACAAGCCCCAGGTGCCA

CCCCGGGTACCTATTCCCCCTCGGCCCACGCGTCCACGTGTGGAGCTATCTCCAGCTCCCTCGGGTGAGGAAGAGACAAGCCGGTGGCCTGGACCTGCCT

CGCCCCCCCGAGTGCCTCCCCGGGAACCTCTGTCTCCTCAAGGTTCAAGGACCCCAAGCCCCCTAGTGCCACCTGGCAGCTCTCCACTACCGCATCGGCT

CTCTAGCTCACCTGGAAAGACCATGCCCACCACTCAAAGCTTTGCCTCAGACCCTAAGTATGCCACTCCACAAGTGATCCAGGCTCCTGGCCCACGGGCA

GGCCCCTGCATCCTGCCCATTGTCCGCGATGGCAGGAAGGTCAGCAGCACTCATTACTACCTGCTGCCTGAGCGCCCTCCTTACCTGGAACGCTATCAGC

GCTTCCTGCGGGAGGCCCAGAGCCCGGAAGAGCCGGCCGCCCTGCCTGTGCCCCCGCTGTTGCCCCCGCCCAGTACTCCAGCCCCTGCTGCCCCCACTGC

CACCGTCAGACCTATGCCTCAGGCCGCCCCAGACCCAAAGGCCAACTTCTCCACCAATAACAGCAACCCAGGGGCACGGCCACCATCCCTGAGGGCCACG

GCTCGGCTGCCACAGAGGGGCTGCCCAGGGGACGGGCAAGAGGCTGCTCGGCCAGCAGACAAGGTCCAGATG GTGGAGCAGCTCTTTGGGCTGGGTCTT

CGGCCACGGGTGGAGTGCCACAAGGTCCTAGAGATGTTCGACTGGAACCTAGAGCAAGCCGGCTGTCACCTTCTGGGCTCCTGTGGCCCTGCTCATCACA

A ACGCTGATGGTTGACTGGAGAGCAGTGGTCTGCCCTAAAAGAACCTCTTGAACCTGTCTGTGGGACAAGGGTGGGGGAGCTGCCCTGCCTCAGGCCCG

AAGGACCCACAACTGCCTGCGGCTCCCAGGGGACAGTGAGACCCAGGCAGCAGGAGGCTGGGAGCCTCACCTTGCCCACCTCGCTCACCCACCCAGCGCT

GTTCTGCACACCTTGGTTCAGCCCTCAGTGCCCCAAGAGGTGGGACGTTCCCAGCCTTGTGAAGGCAAGACAGGAAGCTGCCTGGCAGGCTCTGTGTGGC

CTGCCTCTGGCTCCAGATCAAGGCTGGGCTGGTGGCTAGAGTGTGCCCCAGGCTTTCCTCTGGGGGATTAGACTGACAGGAAGCCAGGCTTGACATGGAC

AAGAAGGATGTGTTGGCCACACAGCAGGGCGAGCCAGCAACCAACAGGCCCTCCTCAGGGCTAGGCCCCTTCCCAGGGAACCCCTGTAGGAGTGTGGAGT

GTTGGACAGAATGTGACCTGTAGCTTCACTGTGAACTTGTGGGCTTGGCTGGTCTTAGGAACTTGTACCTATAAACAGCCTGAAGTGGCTCAGAAACAGA

AAAGGTGCCAGGATCTTCTCTGGCAGGGACCAGGGCCCAAGGCCCCGGATGTGGAAGGAGACCCCAGTGGCACCAGTACTTTCCTGTTTGACCTGTTCCT

CCCCTGTTGCTATCTGATGTGTTCCCATCAGCCTCTGTTGCCAAAGTCGTGGCCCCAGCTATGGATATCTGCTTCTTCCAGAGAAATAAAGCTTGTTTCT

ATTTTATGTTA
Translation
 - UNI21339 - MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNITRLSHFEYVKNEDLEKIGMGRPG - UNI21339 - GQRRLWEAVKRRKAMCK

RKSWMSK VFSGKRLEAEFPSQHSQSTFRKPSPTPGSLPGEGTLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPAGKT VSVAVKCLKPDVLSQPE

AMDDFIREVNAMHSLDHRNLIRLYGVVLTLPMKM VTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMAYLESKRFIHRDLAARNLLLATRDLVKI

GDFGLMRALPQNDDHYVMQEHRKVPFAW WCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQ ILHKIDKEGERLPRPEDCPQDIYNVMV

QCWAHKPEDRPTFVALRDFLLE AQPTDMRALQDFEEPDKLHIQMNDVITVIEGR - UNI25326 - RAENYWWRGQNTRTLCVGPFPRNVVTSVAGL

SAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDE ELYLGNPMDPPDLLSVELSTSRPTQHLGRVKR REPPPRPPQPAIFTQK KPTYDPVSEDPDPL

SSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARP

LPPPPAYDDVAQDEDDFEVCSINSTLVGAGLPAGPSQGETNYAFVPEQAQMPPALEDNLFLPPQGGGKPPSSVQTAEIFQALQQECMRQLQVPTGQLTPS

PTPGGDDKPQVPPRVPIPPRPTRPRVELSPAPSGEEETSRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPHRLSSSPGKTMPTTQSFASDPKYA

TPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAALPVPPLLPPPSTPAPAAPTATVRPMPQAAPDPKANFSTNNS

NPGARPPSLRATARLPQRGCPGDGQEAARPADKVQM VEQLFGLGLRPRVECHKVLEMFDWNLEQAGCHLLGSCGPAHHK KR

For any suggestions or comments, please send an email to unitrap@crg.es