Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022792 (Yars2)
Chromosomal location
Chr 16: 16303075 - 16309720 (+)
Description
tyrosyl-tRNA synthetase 2 (mitochondrial) Gene [Source:MGI Symbol;Acc:MGI:1917370]
RefSeq_dna
NM_198246 
RefSeq_peptide
NP_937889.1 
UniGene
Mm.37486 
MGI
MGI:1917370 
Uniprot/SWISSPROT
Q8BYL4 
Uniprot/SPTREMBL
Q8BJJ2 
Human Ortholog
ENSG00000139131 (YARS2)
Omim not available
UniTrap UNI11158
Vector Insertion
Chr 16: 16303841 - 16304628
Public Clones G059G10 (ggtc)
Private Clones OST437744 (lexicon) OST80899 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11071
Vector Insertion
Chr 16: 16304797 - 16306555
Public Clones E126E05 (ggtc) G063D02 (ggtc) IST14591G11 (tigm) IST14640D7 (tigm)
IST14935H3 (tigm) IST13435C1 (tigm) IST12981D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059955
Sequence
AGATGGCGGCGCCCATGCTGAGGCGCCTGTGCCGCGTTCCGCAGTCCCTGGTCTGGCTACGAGGGTCGCGTGCGGTGCGCCCGGGCGCGCGGGGAATGCT

GGTGGCACCGAGGGCCCGCGGCTTGTTCAAGGAGTTCTTCCCCGAGAGCGGCACGAAGACAGAGCTCCCCGAACTCTTTGACCGCCGCAGGGCGGGCTCG

TCCCCCCAGACGGTGTACTGCGGCTTCGACCCCACGGGCGACTCGCTCCACGTGGGGCACCTGCTAACTCTGTTGGGGCTCTTCCACTTCCAGCGAGCCG

GCCACAACGTGATCGCGCTCGTGGGAGGCTCCACGGCCCTCCTGGGGGACCCCAGCGGCCGGACCAAGGGGCGCGAGGCGCTGAGCGCCGAGTGCGTGCG

GGCCAACGCGCACGCCCTGCGGCGAGGGCTCGAGGCCCTGGCGGCCAACCACGCGCGCCTCTTCGCGGACGGCCGGCCCTGGGGCTCTTTCACGGTGCTG

GACAACGCGGCCTGGTTCCAGGAGCAGCACCTGGTGGATTTCCTGGCCACGGTGGGCGGCCACTTCCGCATGGGCACTCTGCTGAGCCGGCTGAGCGTGC

AGTCGCGTCTCAAGAGCCCCGAGGGCATGAGCTTGGCGGAGTTCTTTTACCAGGTGCTCCAGGCCTATGACTTCTACTACCTTTTCCAGCACTATGGATG

CCGGGTCCAACTGGGCGGATCAGATCAGTTGGGCAACATCATGTCTGGCTACGAGTTCATCCACAA - UNI11158 - GTTGACTGGAGAGGATGTGT

TTGGAATCACTGTACCTCTAATTACAAGTACAACTGGAGCAAAGCTGGGAAAGTCTGCTGGCAATGCGGTTTGGCTAAACAGAGAGAAAACATCACCGTT

TGAACTTTATCAGTTCTTTGTCAGACAGCAAGATGATTCCGTAGAAAG - UNI11071 - GTACCTGAAGCTTTTCACTTTCCTTCCCCTCCCAGAGA

TCGATCACATCATGCAGCTACATGTCAAAGAACCAGAAAAGCGAGTTGCTCAGAAACGACTTGCTGCAGAAGTAACAAAGCTTGTTCACGGACAAGAAGG

TCTGGACTCTGCTAAAAG GTGTACACAAGCCCTTTACCATAGCAGCATAGAGGCACTGGAGGTCATGTCTGACCAAGAGTTAAAAGAATTGTTTAAAGA

AGCTTCATTTTCTGAATTAGTTCTTGATCCTGGAACGAGTGTCATAGACACATGCCGTAAAGCAAATGCCATTCCTGATGGCCCTCGAGG GTATCGGAT

GATAACAGAAGGTGGAGTCAGTATAAATCACAGACAGGTAACAAATCCTGAAAGTGTTCTAGTAATTGGACAACATATTCTCAAGAATGGACTTTCCTTA

CTTAAAATAGGAAAAAGGAATTTCTACATTATAAAATGGCTTCAGTTGTGAAAGGTTTTGTCCAAATTTGTCCATCATCCATTTTCAAAATGTGGAGGTC

TTCGGAAACCCAAGAGTGGAATATACACAAGGCCCCTCACAATGTAAATACTCATGTGCATTTCAAAATAAAATGTTACTTAATTGT
Translation
MAAPMLRRLCRVPQSLVWLRGSRAVRPGARGMLVAPRARGLFKEFFPESGTKTELPELFDRRRAGSSPQTVYCGFDPTGDSLHVGHLLTLLGLFHFQRAG

HNVIALVGGSTALLGDPSGRTKGREALSAECVRANAHALRRGLEALAANHARLFADGRPWGSFTVLDNAAWFQEQHLVDFLATVGGHFRMGTLLSRLSVQ

SRLKSPEGMSLAEFFYQVLQAYDFYYLFQHYGCRVQLGGSDQLGNIMSGYEFIHK - UNI11158 - KLTGEDVFGITVPLITSTTGAKLGKSAGNAV

WLNREKTSPFELYQFFVRQQDDSVER - UNI11071 - RYLKLFTFLPLPEIDHIMQLHVKEPEKRVAQKRLAAEVTKLVHGQEGLDSAKR RCTQAL

YHSSIEALEVMSDQELKELFKEASFSELVLDPGTSVIDTCRKANAIPDGPRG GYRMITEGGVSINHRQVTNPESVLVIGQHILKNGLSLLKIGKRNFYI

IKWLQL

For any suggestions or comments, please send an email to unitrap@crg.es