Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022812 (Gsk3b)
Chromosomal location
Chr 16: 38089610 - 38241236 (+)
Description
glycogen synthase kinase 3 beta Gene [Source:MGI (curated);Acc:Gsk3b-001]
RefSeq_dna
NM_019827 
RefSeq_peptide
NP_062801.1 
UniGene
Mm.394930 
MGI
MGI:1861437 
Uniprot/SWISSPROT
Q9WV60 
Uniprot/SPTREMBL
Q3TB31 Q5KU03 
Human Ortholog
ENSG00000082701 (GSK3B)
Omim not available
UniTrap UNI341
Vector Insertion
Chr 16: 38089609 - 38090700
Public Clones GC0921 (tigem) DA0054 (sanger) YHD069 (baygenomics) YHB105 (baygenomics)
XE136 (baygenomics) A047D08 (ggtc)
Private Clones OST234950 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20380
Vector Insertion
Chr 16: 38090700 - 38144345
Public Clones (sanger) D089H11 (ggtc) CMHD-GT_473E3-3 (cmhd) IST11564F8 (tigm)
IST13027A9 (tigm) IST11196D12 (tigm) IST14906F9 (tigm) IST10761F5 (tigm)
Private Clones OST365110 (lexicon) OST77947 (lexicon) OST53827 (lexicon) OST51048 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7587
Vector Insertion
Chr 16: 38144540 - 38170749
Public Clones RRR398 (baygenomics) RRP018 (baygenomics) (ggtc) IST11469C2 (tigm)
IST12980A1 (tigm) IST12085E6 (tigm) IST15053G1 (tigm) IST10462G6 (tigm)
IST11269F8 (tigm) IST13020D2 (tigm) IST12650D4 (tigm) IST10844G11 (tigm)
IST10708H8 (tigm) IST14197A12 (tigm) IST11772F12 (tigm) IST12837A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4411
Vector Insertion
Chr 16: 38170834 - 38184520
Public Clones AD0762 (sanger) CMHD-GT_430D8-3 (cmhd) CMHD-GT_310A10-3 (cmhd) IST14810B7 (tigm)
IST12553H11 (tigm) IST14866F6 (tigm) IST13024G10 (tigm)
Private Clones OST470247 (lexicon) OST457913 (lexicon) OST457541 (lexicon) OST381800 (lexicon)
OST355851 (lexicon) OST325580 (lexicon) OST215812 (lexicon) OST66461 (lexicon)
OST56209 (lexicon) OST49112 (lexicon) OST16947 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13473
Vector Insertion
Chr 16: 38184632 - 38187896
Public Clones CMHD-GT_277H03-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9096
Vector Insertion
Chr 16: 38194081 - 38208080
Public Clones XK491 (baygenomics)
Private Clones OST61575 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10101
Vector Insertion
Chr 16: 38220245 - 38228763
Public Clones XC303 (baygenomics)
Private Clones OST410543 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6057
Vector Insertion
Chr 16: 38228863 - 38240587
Public Clones YHD099 (baygenomics)
Private Clones OST414058 (lexicon) OST413062 (lexicon) OST406555 (lexicon) OST51047 (lexicon)
OST45402 (lexicon) OST45401 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114750
Sequence
ATCATCTATGTGTTAAATATCCGTACCGATCTGTCTTGAAGAAATACATAGCTCCTTTTTTTTTTCCTTCTTCTTAAATAGCTATACAAAAGGAGTGAAA

AGCCAAGAGAACGAAGTCTTTCTTTCTCTTTCTTGCGGGAGAACTTAATGCTGCATTTATCATTAACCTAGCACCCTAACATAAAACAAAAGGAAGAAAA

GGATTAAGGAAGGAAAAGGTGATTCAAGAAGAGCCATCATGTCGGGGCGACCGAGAACCACCTCCTTTGCGGAGAGCTGCAAGCCAGTGCAGCAGCCTTC

AGCTTTTGGTAGCATGAAAGTTAGCA - UNI341 - - UNI20380 - GAGATAAAGATGGCAGCAAGGTAACCACAGTAGTGGCAACTCCTGGCCA

GGGTCCTGACAGGCCACAGGAAGTCAGTTATACAGACACGAAAGTGATTGGAAATGGATCATTTGGTGTGGTATATCAAGCCAAACTTTGTGATTCTGGA

GAACTGGTTGCCATCAAGAAAGTTCTACAGGACAAGCGATTTAAG - UNI7587 - AACCGAGAGCTCCAGATCATGAGAAAGCTAGACCACTGTAAC

ATAGTCCGACTGCGGTATTTCTTCTACTCGAGTGGTGAGAAG - UNI4411 - AAAGATGAGGTCTACCTTAACCTGGTGCTGGACTATGTTCCGGAG

ACAGTGTACAGAGTCGCCAGACACTATAGTCGAGCCAAGCAGACACTCCCTGTGATCTATGTCAAG - UNI13473 - TTGTATATGTATCAGCTGTT

CAGAAGTCTAGCCTATATCCATTCCTTTGGAATCTGCCATCGAGACATTAAACCACAGAACCTCTTGTTGGATCCTGATACAGCTGTATTAAAACTCTGT

GACTTTGGAAG TGCAAAGCAGCTGGTCCGAGGAGAGCCCAATGTTTCATATATCTGTTCTCGGTACTACAGGGCACCAGAGTTGATCTTTGGAGCCACT

GATTACACGTCCAGTATAG ATGTATGGTCTGCAGGCTGTGTGTTGGCTGAATTGTTGCTAGGACAACCAATATTTCCTGGGGACAGTGGTGTGGATCAG

TTGGTGGAAATAATAAAG - UNI9096 - GTCCTAGGAACACCAACAAGGGAGCAAATTAGAGAAATGAACCCAAATTATACAGAATTCAAATTCCCT

CAAATCAAGGCACATCCTTGGACAAAG GACTCACCAGGAGCAGGACATTTCACCCCAGGAGTGCGG GTCTTCCGGCCCCGAACTCCACCAGAGGCAAT

TGCACTGTGCAGCCGTCTGCTGGAGTACACACCTACCGCCCGGCTAACACCACTGGAAGCTTGTGCACATTCATTTTTCGATGAATTGCGGGACCCAAAT

GTCAAACTACCAAATGGGCGAGACACACCTGCACTCTTCAACTTTACCACTCAAG - UNI10101 - AACTGTCAAGTAACCCCCCTCTGGCCACCAT

CCTTATCCCTCCACATGCTCGGATTCAGGCCGCTGCTTCACCGCCTGCCAACGCCACAGCAGCCTCAG - UNI6057 - ATACTAATGCTGGAGACCG

TGGACAGACCAATAACGCCGCTTCTGCATCAGCTTCCAACTCCACCTGAACAGCCCCCAGGAGCCAGCTGCGCGGGAAAGACCAGCACTTACTTGAGTGC

CACTCAGCAACACTGGTCACGTTTGGAAAGAAAATTAAAAAGAGGAAAACAAAAACAAAAACAAAAAAACCCTGTTCATTTTAGTGTTCAATTTTTTTTA

TTGTTGTTCTTATTTAACCTTGTAAAATATCTATATAAATACAAACCAGTTTCATTGTA
Translation
MSGRPRTTSFAESCKPVQQPSAFGSMKVSR - UNI341 - - UNI20380 - RDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAK

LCDSGELVAIKKVLQDKRFK - UNI7587 - NRELQIMRKLDHCNIVRLRYFFYSSGEK - UNI4411 - KDEVYLNLVLDYVPETVYRVARHYSR

AKQTLPVIYVK - UNI13473 - LYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGS SAKQLVRGEPNVSYICSRYYRAPELIFGAT

DYTSSID DVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK - UNI9096 - VLGTPTREQIREMNPNYTEFKFPQIKAHPWTK DSPGAGHFTPGVR

 VFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQE - UNI10101 - ELSSNPPLATILIPPHARIQAA

ASPPANATAASD - UNI6057 - DTNAGDRGQTNNAASASASNST
Transcript ENSMUST00000023507
Sequence
ACAGAGCAGCCCCCGACCCGGCCGAATGCGGGCTTGTGTCGCCGCCGTCGCCGCCGCCTGGGCCGAGTGACAAAGGAAGGAAGGCAGCAAGGAGGAGCCG

GCCTTGCAGCCGCTGACAGGGCTTCGGGCTCCGGGCACAGCGCGGACACTTCCCGAGCAGCCGCTGAGCAAAGGCGAGGGGCGGAGGCCGGCCGTGCCGG

GGCCACGGACGGGGGAGGGGACCCCGAGGGACGGAAGCGGTTGCCTGGTTCCCATGTCCCCGGCGTATGGGGAGCAGTCAGGGAGCCGCTGCCTGGGGTC

TGAAGGGAGCTGCCTCCGCCGCCGCTGCCGCCATGGCCGCTGGATCCAGCCACCGCCTGCAGCTGCTCCTGGCGCAATGAGGAGAGGAGCCGCCGCCACC

GCCCGCCGCTGACTCGCGACTGCGCTGCCCTCCGGTTCACCCGGCCGCCGCCGCCGTCAGACCGCCGGATCCCGCTGCTGCCGGAGCCGCAGCGTTTGCC

GTCGCATCTCCGAGCCATCTCCTCCCTCCTTCCCATCCCCCTTCTCTTCAAGCGTGAGGCTCGTGATCCTTCCGCCGCTTCCCTTCTTCATTGACTCGGA

AAAAAATCCCCGAGGAAAAATATAATACTCAGAGTACTTATTTTCAATCAAGTATTTGCCCTCGTTCACGTGATATATATATATTTTTAAGGATTCCACT

CCACCCTTTTTCTCCTCTTCCAGGAAAGGGAGGTGAAAGAATTGTATTTTTCTCCCAGCTCTAAATCATCTATGTGTTAAATATCCGTACCGATCTGTCT

TGAAGAAATACATAGCTCCTTTTTTTTTTCCTTCTTCTTAAATAGCTATACAAAAGGAGTGAAAAGCCAAGAGAACGAAGTCTTTCTTTCTCTTTCTTGC

GGGAGAACTTAATGCTGCATTTATCATTAACCTAGCACCCTAACATAAAACAAAAGGAAGAAAAGGATTAAGGAAGGAAAAGGTGATTCAAGAAGAGCCA

TCATGTCGGGGCGACCGAGAACCACCTCCTTTGCGGAGAGCTGCAAGCCAGTGCAGCAGCCTTCAGCTTTTGGTAGCATGAAAGTTAGCA - UNI341 

- - UNI20380 - GAGATAAAGATGGCAGCAAGGTAACCACAGTAGTGGCAACTCCTGGCCAGGGTCCTGACAGGCCACAGGAAGTCAGTTATACAGA

CACGAAAGTGATTGGAAATGGATCATTTGGTGTGGTATATCAAGCCAAACTTTGTGATTCTGGAGAACTGGTTGCCATCAAGAAAGTTCTACAGGACAAG

CGATTTAAG - UNI7587 - AACCGAGAGCTCCAGATCATGAGAAAGCTAGACCACTGTAACATAGTCCGACTGCGGTATTTCTTCTACTCGAGTGGT

GAGAAG - UNI4411 - AAAGATGAGGTCTACCTTAACCTGGTGCTGGACTATGTTCCGGAGACAGTGTACAGAGTCGCCAGACACTATAGTCGAGCC

AAGCAGACACTCCCTGTGATCTATGTCAAG - UNI13473 - TTGTATATGTATCAGCTGTTCAGAAGTCTAGCCTATATCCATTCCTTTGGAATCTG

CCATCGAGACATTAAACCACAGAACCTCTTGTTGGATCCTGATACAGCTGTATTAAAACTCTGTGACTTTGGAAG TGCAAAGCAGCTGGTCCGAGGAGA

GCCCAATGTTTCATATATCTGTTCTCGGTACTACAGGGCACCAGAGTTGATCTTTGGAGCCACTGATTACACGTCCAGTATAG ATGTATGGTCTGCAGG

CTGTGTGTTGGCTGAATTGTTGCTAGGACAACCAATATTTCCTGGGGACAGTGGTGTGGATCAGTTGGTGGAAATAATAAAG - UNI9096 - GTCCT

AGGAACACCAACAAGGGAGCAAATTAGAGAAATGAACCCAAATTATACAGAATTCAAATTCCCTCAAATCAAGGCACATCCTTGGACAAAG GTCTTCCG

GCCCCGAACTCCACCAGAGGCAATTGCACTGTGCAGCCGTCTGCTGGAGTACACACCTACCGCCCGGCTAACACCACTGGAAGCTTGTGCACATTCATTT

TTCGATGAATTGCGGGACCCAAATGTCAAACTACCAAATGGGCGAGACACACCTGCACTCTTCAACTTTACCACTCAAG - UNI10101 - AACTGTC

AAGTAACCCCCCTCTGGCCACCATCCTTATCCCTCCACATGCTCGGATTCAGGCCGCTGCTTCACCGCCTGCCAACGCCACAGCAGCCTCAG - UNI60

57 - ATACTAATGCTGGAGACCGTGGACAGACCAATAACGCCGCTTCTGCATCAGCTTCCAACTCCACCTGAACAGCCCCCAGGAGCCAGCTGCGCGGG

AAAGACCAGCACTTACTTGAGTGCCACTCAGCAACACTGGTCACGTTTGGAAAGAAAATTAAAAAGAGGAAAACAAAAACAAAAACAAAAAAACCCTGTT

CATTTTAGTGTTCAATTTTTTTTATTGTTGTTCTTATTTAACCTTGTAAAATATCTATATAAATACAAACCAGTTTCATTGTATTCTCACTTTTCAGGAG

ATCCAAGAGGTGGGGAGGGTTGGGCGGGGAGGAGCAGAGCATTAAACACAATCTCTCCCACGACAATCTTTTCTTTTCTTTTTAAAGTCAGAAGTCCGCT

ATTGTATACCTTAAAAACCAGACTCCTGCCTCACGCCCCCACCGCAACAGAAGAAAACCTGTTCTGTGCTGGTTTATTTTCTGGATTTGTTTTCTTTTAA

AGCCTGGCGTAAGACTTTGATACAGTGCACAGCTTGAAATTGGTTGGGAGCTTAGCAGGTGTAACTCACCAGGGACTTACTGTCACTTGTACAATGTGTA

CTTATCCTTAGGATTTGAAGACTTGCCTTTGGCGTGTGATGTCAGGTATGACAG
Translation
MSGRPRTTSFAESCKPVQQPSAFGSMKVSR - UNI341 - - UNI20380 - RDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAK

LCDSGELVAIKKVLQDKRFK - UNI7587 - NRELQIMRKLDHCNIVRLRYFFYSSGEK - UNI4411 - KDEVYLNLVLDYVPETVYRVARHYSR

AKQTLPVIYVK - UNI13473 - LYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGS SAKQLVRGEPNVSYICSRYYRAPELIFGAT

DYTSSID DVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK - UNI9096 - VLGTPTREQIREMNPNYTEFKFPQIKAHPWTK VFRPRTPPEAIAL

CSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQE - UNI10101 - ELSSNPPLATILIPPHARIQAAASPPANATAASD -

 UNI6057 - DTNAGDRGQTNNAASASASNST

For any suggestions or comments, please send an email to unitrap@crg.es