Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022816 (Fstl1)
Chromosomal location
Chr 16: 37777141 - 37836602 (+)
Description
follistatin-like 1 Gene [Source:MGI (curated);Acc:Fstl1-001]
RefSeq_dna
NM_008047 
RefSeq_peptide
NP_032073.2 
UniGene
Mm.471956 Mm.182434 
MGI
MGI:102793 
Uniprot/SWISSPROT
Q62356 
Uniprot/SPTREMBL
Q6GTX2 
Human Ortholog
ENSG00000163430 (FSTL1)
Omim not available
UniTrap UNI11511
Vector Insertion
Chr 16: 37777239 - 37777379
Public Clones P072A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI233
Vector Insertion
Chr 16: 37777437 - 37814242
Public Clones GC0681 (tigem) (sanger) P086B03 (ggtc) P084B02 (ggtc) G052H05 (ggtc)
P086F08 (ggtc) P072G09 (ggtc) IST10762C12 (tigm) IST10046H7 (tigm)
IST11552E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19828
Vector Insertion
Chr 16: 37815590 - 37815791
Public Clones not available
Private Clones OST379353 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023511
Sequence
TTGAAGAGGCCACTGGAATTGTCTTTTATAACAATCAGCACTGTCTTTTT TGAG - UNI19828 - GAGGAACCTAGAAGCAAATCCAAGATCTGCG

CCAATGTGTTTTGTGGAGCTGGCAGGGAATGTGCCGTCACAGAGAAGGGGGAGCCCACGTGCCTCTGCATTGAG CAATGCAAACCTCACAAGAGGCCTG

TGTGTGGCAGTAATGGCAAGACCTACCTCAACCACTGTGAACTTCATAGAGATGCCTGCCTCACTGGATCCAAGATCCAGGTTGATTATGATGGGCACTG

CAAAG AAAAGAAGTCTGCGAGTCCATCTGCCAGCCCAG TTGTCTGCTATCAAGCTAACCGCGATGAGCTCCGACGGCGCCTCATCCAGTGGCTGGAAG

CTGAGATCATTCCAGATGGCTGGTTCTCTAAAGGCAGTAACTACAGTGAGATCCTAGACAAGTACTTTAAG AGCTTTGATAATGGCGACTCTCACCTGG

ACTCCAGTGAATTCCTGAAATTCGTGGAGCAGAATGAAACAGCCATCAACATCACCACTTATGCAGATCAGGAGAACAACAAACTGCTCAG AAGCCTCT

GTGTTGACGCCCTCATTGAACTGTCTGATGAGAACGCTGACTGGAAACTCAGCTTCCAAGAGTTCCTCAAGTGCCTCAACCCATCCTTCAACCCTCCTGA

GAAGA AGTGTGCCCTGGAGGACGAAACCTATGCAGATGGAGCTGAGACTGAGGTGGACTGCAATCGCTGTGTCTGTTCCTGTGGCCACTGGGTCTGCAC

AGCAATGACCTGTGATG GAAAGAATCAGAAGGGGGTCCAGACCCACACAGAGGAGGAGAAGACAGGATATGTCCAGGAACTCCAGAAGCACCAG GGCA

CAGCAGAAAAGACCAAGAAGGTGAACACCAAAGAGATCTAAGAAGAGGCACAGAGCACCGTGTCCGGAGCCCAGCGCCTCCTCTTCAGCGCTGAGCCCAG

TACACACAGAGTCTGCAGCAATCACCAAATCACTAGTATTTGCTTGTATGGCAGCGAATCTTATTTTGTTTGTTTTGCAATAAAGGAAATGAGGGTGGCC

AGCCTAGCGAGGGAAGGCCACAACCTTCACCTGTAGGAATGCTTTAAGAGAAACTAAAGGACACCTTGGGACGAGAGGCAACTAAGGAAACAGCATCGGG

TTGGCAGAGGAGCAGAGGCAGGTTTGAATGAAGCCTTTCTGGGGTCACAGCAGCTGCGAGGAGAATACAGGAAAAGCATAGAGAAACATTGAACTAGCCC

TGCTGGAGGAAGTGGGGGGAGCTTTGTAGGGAGGAACCCTGCTGCTTTGACCCTTGTCACCACTGTCAGCATGACAGACCTGCAGCAAGTCTGCTTCTCC

TTTTGGTCCCAACAATCACCTGAACACACAGCCGCCCAACTAGTTACCTGTGTCCCTCAGCCTTGCATGGAGTTTCCTGGAGGAGGTGTTTAAATGATGC

AGACACTTATGTACTTCAAGCGCCATGGAGACCTAACCAAATTTTTAAAATACATTTTTCTTTTTTTTTTTTTTTTGTTAACCAAAGGTGCTATTTCTCT

GTAAAAGACTTTTTTCCAAGCTGACTTCATTCCTCAGTTATTACCGTTATATTATTGTTGTTTTTTAATATTTCATTTTTTGACTAGATATTAAGCTTTT

GTAATTATTTTTTCATTAGTCCTACTATTTCAGAAGTGAAGGTGAAGGGGGTTTGGGCATTTTTCCAGGTACAGGGAACTCTGTAACACAAACAGCCCAT

ACCCTGTCACATATTAGACCGGTTGCAGTTCGGAGCTGCACCCCAACCCAGAGCTTCTAGAAAATCAGCTCCATGCCACGAAGCACAAGAGGCCCCTCAG

ACAGAAGCCACAGGACAAAGCATCTTCATAGACAGCTGTTGAGATCCAAACAGTTAATTTGCTTTTGTTTCTTGTAAGAAGTTCCAAGGATGGACGCTCA

GGCTATCCCAGCCTGCCAGCCTGCTGTGATCTGTGGCTAACTGGCAGAGTCAGCCACTGTGGTCCTTAGCTGCTCCTGTTTCTAGGTGTCAGTTTACTTA

GTAAACTGGTAAGAATGAATCTTGGAATTTAATAAATGGTAGTTTGTGGTTTAGCCAACTGGTCCAGAGGGAGCTACCTTCTCCTTAGGATAGATGAATC

TACACCATAAGAAAAACCAGCCAGGAATAGCATGGATGGGTTTTGCTTTGGTTGAAATGATCCTAGCAGGTGACTGGGTATGAGGACTTCATGGTCACTC

TGCCCAGGAAGAGAGCGTGAAGGACAACTAGCAGCTTCCTTAGGGATGGTACACATGAGTGTGATCTCTGGAGTCAGAGGTTTCCCCACACACATGATGA

TAAAACTTTTCAGATTTAGAGCGGTTAAAACTGGAGATCGAATCTGGATTGAGAATCAGCACTGGGGGAGAAACTGTTATTGAAAGTCAATCCTTTCTTT

GAGCCTCCGAATAAACTATGGAGATTTTCCTGCATAGGAAAGTGTGGAATGTTGAGCTATTGAGATGGGAGTGGAATTCGTCCTAAATAGTTTTTCCTGG

TCTCATCTGAACAAGACAATTTGGCTCTGCCTAGTGTTCTGTGCCCTCCCTTTCAAAAGCTCTGAGCCCCGCTCATGCAGTCCAGATTTCATCCCCCTCT

CCAAGTGCCTTGGAGAGCTCACAGCAGCAATGCCATCATCAAAAGTTTTGCTGCTGGGAAGAAAAAAAAAAAAAAAAAAGAAAAAAAAAGTTTTGCTGGT

TCTTGGAGGTGATGGGAGAGGGCAGGAGTATCAATTTGTTCAAGTAGCTGCAGTGTCTGTTGGCCAATCATCTTTAGAACCCTGTAACACTGAGTACCAG

AGGGCAAGCCCACATTCCTCTTCTGCTACTTCAGTGTAACTAGGGCAGCTGTTGTCTGAAGCACCATAGATTCAGGTGATCCTCCATAGATTCAGGTGAT

CCTCCATAGATTCAGGTGATCCTTGAACCGTTCATGAAAAGCTGCTAAGTAGCCTGGTTTGGGAGACTTGGGTTGAGATTTGCATGGGACCAACACGCAG

GATTACATCTTCTTCAGTTCCTAGAGTCCTCTAGAAGCCTATAGAACAAGACGGCAAGCTCTCTGGGCTTGCTCTGGGGTTTTGTTCTGTGGTTTTATGT

TGTTCTTGTTGTTTTATTAACATCAGTGTCTCTTAAGATCCAGGACCCAGGGAGGTCTTTTCACATACATATACCAGGACTCTTGGGTACTACTGTCAGT

CTTGGGGAAGCAGGCTCCTCCATCGGCAACCAAATCCATGTGAGCACTCCGAATGCCTTGGTTAGTCCTATGACCTAAATAGTTAAACTTCAGAAAATGG

TTTCAACAGATTTCTGTGCCGAGTGGTTTTGAAATTGCATTTGTATTTGCTGTGCTTCTGTATTCCATTTAACTGGGTTTTTTGTTACTTCTGATTTTTG

TTACTATTAATAAATAAAAATAAAATAAAAT
Translation
LKRPLELSFITISTVFF FE - UNI19828 - EEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIE QCKPHKRPVCGSNGKTYLNHCELHRDACLT

GSKIQVDYDGHCKE EKKSASPSASPV VVCYQANRDELRRRLIQWLEAEIIPDGWFSKGSNYSEILDKYFK SFDNGDSHLDSSEFLKFVEQNETAINI

TTYADQENNKLLR RSLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKK KCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDG GKNQKGV

QTHTEEEKTGYVQELQKHQ GTAEKTKKVNTKEI
Transcript ENSMUST00000114763
Sequence
TTCCTCGGAGCCTGGTGATAAGCGACGCTCCCACCTTCGCCTCTAACTCGCTGCCGCCACCCTGCCCAGTGTCCTCCGGAGTCCCGGACCCGAGCACG -

 UNI11511 - ATGTGGAAACGATGGCTGGCGCTCTCGCTGGTGACCATCGCCCTGGTCCACGGCGAG - UNI233 - - UNI19828 - GAGGAA

CCTAGAAGCAAATCCAAGATCTGCGCCAATGTGTTTTGTGGAGCTGGCAGGGAATGTGCCGTCACAGAGAAGGGGGAGCCCACGTGCCTCTGCATTGAG 

CAATGCAAACCTCACAAGAGGCCTGTGTGTGGCAGTAATGGCAAGACCTACCTCAACCACTGTGAACTTCATAGAGATGCCTGCCTCACTGGATCCAAGA

TCCAGGTTGATTATGATGGGCACTGCAAAG AAAAGAAGTCTGCGAGTCCATCTGCCAGCCCAG TTGTCTGCTATCAAGCTAACCGCGATGAGCTCCGA

CGGCGCCTCATCCAGTGGCTGGAAGCTGAGATCATTCCAGATGGCTGGTTCTCTAAAGGCAGTAACTACAGTGAGATCCTAGACAAGTACTTTAAG AGC

TTTGATAATGGCGACTCTCACCTGGACTCCAGTGAATTCCTGAAATTCGTGGAGCAGAATGAAACAGCCATCAACATCACCACTTATGCAGATCAGGAGA

ACAACAAACTGCTCAG AAGCCTCTGTGTTGACGCCCTCATTGAACTGTCTGATGAGAACGCTGACTGGAAACTCAGCTTCCAAGAGTTCCTCAAGTGCC

TCAACCCATCCTTCAACCCTCCTGAGAAGA AGTGTGCCCTGGAGGACGAAACCTATGCAGATGGAGCTGAGACTGAGGTGGACTGCAATCGCTGTGTCT

GTTCCTGTGGCCACTGGGTCTGCACAGCAATGACCTGTGATG GAAAGAATCAGAAGGGGGTCCAGACCCACACAGAGGAGGAGAAGACAGGATATGTCC

AGGAACTCCAGAAGCACCAG GGCACAGCAGAAAAGACCAAGAAGGTGAACACCAAAGAGATCTAAGAAGAGGCACAGAGCACCGTGTCCGGAGCCCAGC

GCCTCCTCTTCAGCGCTGAGCCCAGTACACACAGAGTCTGCAGCAATCACCAAATCACTAGTATTTGCTTGTATGGCAGCGAATCTTATTTTGTTTGTTT

TGCAATAAAGGAAATGAGGGTGGCCAGCCTAGCGAGGGAAGGCCACAACCTTCACCTGTAGGAATGCTTTAAGAGAAACTAAAGGACACCTTGGGACGAG

AGGCAACTAAGGAAACAGCATCGGGTTGGCAGAGGAGCAGAGGCAGGTTTGAATGAAGCCTTTCTGGGGTCACAGCAGCTGCGAGGAGAATACAGGAAAA

GCATAGAGAAACATTGAACTAGCCCTGCTGGAGGAAGTGGGGGGAGCTTTGTAGGGAGGAACCCTGCTGCTTTGACCCTTGTCACCACTGTCAGCATGAC

AGACCTGCAGCAAGTCTGCTTCTCCTTTTGGTCCCAACAATCACCTGAACACACAGCCGCCCAACTAGTTACCTGTGTCCCTCAGCCTTGCATGGAGTTT

CCTGGAGGAGGTGTTTAAATGATGCAGACACTTATGTACTTCAAGCGCCATGGAGACCTAACCAAATTTTTAAAATACATTTTTCTTTTTTTTTTTTTTT

TGTTAACCAAAGGTGCTATTTCTCTGTAAAAGACTTTTTTCCAAGCTGACTTCATTCCTCAGTTATTACCGTTATATTATTGTTGTTTTTTAATATTTCA

TTTTTTGACTAGATATTAAGCTTTTGTAATTATTTTTTCATTAGTCCTACTATTTCAGAAGTGAAGGTGAAGGGGGTTTGGGCATTTTTCCAGGTACAGG

GAACTCTGTAACACAAACAGCCCATACCCTGTCACATATTAGACCGGTTGCAGTTCGGAGCTGCACCCCAACCCAGAGCTTCTAGAAAATCAGCTCCATG

CCACGAAGCACAAGAGGCCCCTCAGACAGAAGCCACAGGACAAAGCATCTTCATAGACAGCTGTTGAGATCCAAACAGTTAATTTGCTTTTGTTTCTTGT

AAGAAGTTCCAAGGATGGACGCTCAGGCTATCCCAGCCTGCCAGCCTGCTGTGATCTGTGGCTAACTGGCAGAGTCAGCCACTGTGGTCCTTAGCTGCTC

CTGTTTCTAGGTGTCAGTTTACTTAGTAAACTGGTAAGAATGAATCTTGGAATTTAATAAATGGTAGTTTGTGGTTTAGCCAACTGGTCCAGAGGGAGCT

ACCTTCTCCTTAGGATAGATGAATCTACACCATAAGAAAAACCAGCCAGGAATAGCATGGATGGGTTTTGCTTTGGTTGAAATGATCCTAGCAGGTGACT

GGGTATGAGGACTTCATGGTCACTCTGCCCAGGAAGAGAGCGTGAAGGACAACTAGCAGCTTCCTTAGGGATGGTACACATGAGTGTGATCTCTGGAGTC

AGAGGTTTCCCCACACACATGATGATAAAACTTTTCAGATTTAGAGCGGTTAAAACTGGAGATCGAATCTGGATTGAGAATCAGCACTGGGGGAGAAACT

GTTATTGAAAGTCAATCCTTTCTTTGAGCCTCCGAATAAACTATGGAGATTTTCCTGCATAGGAAAGTGTGGAATGTTGAGCTATTGAGATGGGAGTGGA

ATTCGTCCTAAATAGTTTTTCCTGGTCTCATCTGAACAAGACAATTTGGCTCTGCCTAGTGTTCTGTGCCCTCCCTTTCAAAAGCTCTGAGCCCCGCTCA

TGCAGTCCAGATTTCATCCCCCTCTCCAAGTGCCTTGGAGAGCTCACAGCAGCAATGCCATCATCAAAAGTTTTGCTGCTGGGAAGAAAAAAAAAAAAAA

AAAAGAAAAAAAAAGTTTTGCTGGTTCTTGGAGGTGATGGGAGAGGGCAGGAGTATCAATTTGTTCAAGTAGCTGCAGTGTCTGTTGGCCAATCATCTTT

AGAACCCTGTAACACTGAGTACCAGAGGGCAAGCCCACATTCCTCTTCTGCTACTTCAGTGTAACTAGGGCAGCTGTTGTCTGAAGCACCATAGATTCAG

GTGATCCTCCATAGATTCAGGTGATCCTCCATAGATTCAGGTGATCCTTGAACCGTTCATGAAAAGCTGCTAAGTAGCCTGGTTTGGGAGACTTGGGTTG

AGATTTGCATGGGACCAACACGCAGGATTACATCTTCTTCAGTTCCTAGAGTCCTCTAGAAGCCTATAGAACAAGACGGCAAGCTCTCTGGGCTTGCTCT

GGGGTTTTGTTCTGTGGTTTTATGTTGTTCTTGTTGTTTTATTAACATCAGTGTCTCTTAAGATCCAGGACCCAGGGAGGTCTTTTCACATACATATACC

AGGACTCTTGGGTACTACTGTCAGTCTTGGGGAAGCAGGCTCCTCCATCGGCAACCAAATCCATGTGAGCACTCCGAATGCCTTGGTTAGTCCTATGACC

TAAATAGTTAAACTTCAGAAAATGGTTTCAACAGATTTCTGTGCCGAGTGGTTTTGAAATTGCATTTGTATTTGCTGTGCTTCTGTATTCCATTTAACTG

GGTTTTTTGTTACTTCTGATTTTTGTTACTATTAATAAATAAAAATAAAATAAAAT
Translation
 - UNI11511 - MWKRWLALSLVTIALVHGE - UNI233 - - UNI19828 - EEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIE QCKPHK

RPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKE EKKSASPSASPV VVCYQANRDELRRRLIQWLEAEIIPDGWFSKGSNYSEILDKYFK SFD

NGDSHLDSSEFLKFVEQNETAINITTYADQENNKLLR RSLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKK KCALEDETYADGAETEVDCNRC

VCSCGHWVCTAMTCDG GKNQKGVQTHTEEEKTGYVQELQKHQ GTAEKTKKVNTKEI

For any suggestions or comments, please send an email to unitrap@crg.es