Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022836 (Mylk)
Chromosomal location
Chr 16: 34785036 - 35002520 (+)
Description
myosin, light polypeptide kinase Gene [Source:MGI (curated);Acc:Mylk-001]
RefSeq_dna
NM_139300 
RefSeq_peptide
NP_647461.3 
UniGene
Mm.401121 Mm.33360 
MGI
MGI:894806 
Uniprot/SWISSPROT
Q6PDN3 
Uniprot/SPTREMBL
Q8CIY5 Q8CIY6 Q8BJ10 B1B1A8 
Human Ortholog
ENSG00000065534 (MYLK)
Omim not available
UniTrap UNI34575
Vector Insertion
Chr 16: 34815689 - 34860649
Public Clones IST13405E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32993
Vector Insertion
Chr 16: 34880384 - 34894896
Public Clones IST14369E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114930
Sequence
ATGCAAG CTATGCCCCCTCAAATCATCCAGTTCCCCGAGGACCAGAAGGTGCGCGCAGGAGAACCTGTGGAGCTGTTTGGGAAAGTGGCTGGCACCCAG

CCCATCACCTGCAAGTGGATGAAGTTCCGAAAGCAG ATCCAGGAGAGCGAGCATATCAAGGTGGAGAATGGCGAGAGCGGCAGCAAGCTCACCATCCTG

GCCGCGCGGCAGGAGCACTGTGGCTGCTACACACTGGTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAAGTCAACCTCACGGTCGTGG ATAAGCCA

GACCCCCCGGCTGGCACACCTTGTGCTTCTGACATTCGGAGTTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGT

CCTACAATGTGGAGATCTGGGACACAGAGGACAAGGTGTGGAAAGAGCTAGCCACGTGCCGCAGCACCTCTTTTAATGTCCAAGACCTGCTGCCTGACCG

CGAGTACAAATTCCGAGTGCGTGCAGTCAACGTCTATGGAACCAGCGAGCCAAGCCAAGAGTCCGAGCTCACAGCTGTGGGAGAGAAACCTGAAG AGCC

AAAGGATGAAGTGGAAGTGTCCGATGATG ACGAAAAGGAACCTGAGGTTGATTACCGGACGGTGACTGTTAACACTGAACAGAAAGTGTCTGATGTGTA

TGACATTGAAGAGCGACTAGGATC TGGGAAGTTTGGACAAGTCTTCCGACTTGTGGAAAAGAAAACTGGAAAAATCTGGGCAGGGAAATTTTTCAAGGC

CTATTCCGCCAAGGAGAAAGACAACATCCGTCAGGAGATCAGCATCATGAACTGCCTCCACCACCCCAAGCTGGTCCAGTGTGTGGATGCCTTCGAAGAA

AAGGCCAACATTGTCATGGTTCTGGAGAT CGTGTCCGGGGGTGAGCTGTTTGAGCGTATCATTGACGAGGACTTCGAGCTGACGGAGCGGGAGTGTATC

AAGTACATGAGGCAGATCTCGGAAGGGGTGGAGTACATCCACAAGCAGGGCATTGTGCACCTGGACCTCAAGCCCGAGAACATCATGTGTGTCAACAAGA

CAGGCACCAGGATCAAGCTCATTGACTTCGGCCTGGCACGGAGACTCG AGAACGCTGGGTCTCTGAAGGTCCTCTTTGGGACCCCAGAGTTTGTGGCTC

CTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTATATTCT GGTCAGCGGACTTTCTCCCTTCATGG

GTGACAATGATAACGAGACCTTAGCCAACGTCACTTCAGCCACCTGGGACTTCGATGACGAGGCATTCGATGAGATCTCCGATGACGCAAAGGATTTCAT

CAGTAACTTGCTGAAGAAAGATATGAA AAACCGTCTGGACTGCACCCAGTGCCTTCAGCACCCATGGCTGATGAAAGACACCAAGAACATGGAGGCCAA

GAAGCTGTCCAAGGACCGGATGAAGAAATACATGGCAAGAAGGAAGTGGCAG AAAACGGGCAATGCTGTGAGAGCCATCGGGAGACTGTCCTCTATGGC

AATGATCTCAGGGCTCAGTGGCAGGAAATCTTCAACAGGGTCACCAACCAGCCCAATCAATGCGGAGAAACTAGAGTCTGAAG ACGATGTCTCCCAAGC

TTTCCTGGAGGCTGTTGCTGAGGAAAAGCCCCATGTGAAACCTTATTTCTCTAAGACCATCCGTGATCTGGAAGTCGTGGAGGGAAGCGCTGCTAGATTT

GACTGCAAGATTGAAG GATACCCAGACCCTGAGGTGGTCTGGTTCAAGGATGACCAATCAATCAGGGAGTCCCGCCACTTCCAGATAGACTACGACGAA

GACGGCAACTGCTCGCTCATCATCAGCGACGTCTGTGGGGATGATGACGCCAAGTACACCTGCAAGGCTGTCAACAGCCTCGGAGAAGCCACCTGCACTG

CGGAGCTCATCGTGGAGACCATGGAGGAAGGGGAAGGGGAGGAGGGGGGAGAGGAGGAGGAGGAGGAGGAGGAGTGAAGCCAAGCCAAACAGAAGCAGTT

CCTAAGTCATTTTAAAAAGGACTAATTCCTTAAAGCTCAAAAAAAAAAAAAAAAAAATCAAAAAAACCAAAGCTAGAAAAGGCACCTGGTGTGGTAGATG

ATCTAGTTAGGCTATTTGGAGGCTGATTCGTCAGCGACGGCGGCTGATGCCTGGGAGATATACTGATGGGCATTACTTTGAATTAGATAGCACCTTAAAC

ACTAGTGCAGCTAGATTCCATTTGGGAGAGATCACCAGCAACTCGTCTAATTGATTTGATTTTAGAGAGAAAATAGCTAAAAGAAATACTCACTTAGAAA

AGGTCAAACATTTCCCAGTTTAACGCACCCTGAAAAATAAAGTTGTCATCAGCCCCTTCCGCCCCGCCCCCCGCCCCCCCCTCCCCAAGCCTCCTGCTGT

AGCTCAACCCAGATCCCCTGGAGATAGAATGTCCAGCCCCCTCCCACCCAATCCAGAGAACCCGCCTTGTCCCATCCTGCGGTGTCTCATTCTGGAAGCG

GTTGAGCCAAGCTGACTCAGGAGACACATTGCCTTCCAACTCTGCACTTTCAAGCTCTGCGTTTCTCTCCCCGCTCCAACTGCTGGGTTTCCTGGCTCTA

ATCCTTGCCTGAGTTACAGCAAGGAGGACATTTATCATGTTTCTTCCATCCTGAAACCAAGTTCCCCGGCTTGTGGATGACTCTGGCTGCCTTGGGGGGG

TGAGAGGTACAGGAAGGGGGGTGTCTCCTCTCCTCTAAAATCCTTAGGAAACTAAACTTACTCCTCTGTGCAGGAGTCTGGCAGCTCCAGACATTTGCAT

GAGAATTCATGAAGGAGAAAAAAAAATCCTTGCTAATGAGCTTTTCCCCCCCTTCAACCAGGATTCCTATTTGTGCTGTGAGCCAACGTCAGCCTGCACG

TGCGGTAGAGTCTTGCACCCAGACTTAAAAGCCCAGTTTGCTGAAGTGCTGGCTTTATTGGGCACTATGAAACTGATGTCAGCAACTGTAGGACTGGGGT

GCTTTGGAATCTCCTTCTAGGCAGTCTGAGTTTAATCCATCTTCATTGGCAACACTCTTCAAAGAGCTTGTCCTGCCTTCTGGGGTCCCCCTTGATCTTT

CTTCCTGAATGTGCATCACGCTTTGTAGCCCCCCCACCCCCAACCTTGACCTGCTCAGTACACTCAGACTTGCATCTTTAGCAGTTTGGTTGTTTTTTTG

TTTTTTTTTTTAAACTTTCTTTCACTTCATTGGCACTTAATTGTTTTTCCTTATAAGACTTTTTGGAGGTCATCAACAAAGACCATAAACTGATATCCTA

GTGTGCTTCCTCTGTGTGTGCGTGTGCGTGTGTGTGTGTGTGTCTAACATTCCAAATACTTTTTTTCTTTTCCACTGTTTGTAAAGGGCAACAAATTAAT

ATTTCAAAGGTTGTTTTAATAGTTCCTTACAACCCGACCTTAAACTACTTCTGTGCAGTCCCACACAGTGCCGACATTAGAGAGATGACATTGCTTTGTC

TTCTCAGCCGCCATCCTTCCTGAGCTGTTTGCTGCTGCATTGCCACTTCTTCCCCTGTTTCGCTTCTCTTAAGCAGTTTCAATATCTTTCATTATAGTCA

CAATATTGCCACGGTTTATTATAATAAGGGGGTTTTAATTTGATTTAGAGCATTCAAAGTGTTTTTCATCACTTTGTGTTTATACTATAATCCTTGAGTG

TATGTTGTGTGTATGTGTGCATGGGTGGTTATGCGTGTGTTCATAGGGTAATGCCTTCTTGGGACTGTGTTACTGTTCTCTCAGTTTATTATGCCATCCA

AATGGTGGACGAGAACGCTATGACTGTAGTTAGCTCACAATTTTTAAATAAAGGATACCACAGTGCATGGTGTTTGTTC
Translation
MQA AMPPQIIQFPEDQKVRAGEPVELFGKVAGTQPITCKWMKFRKQ IQESEHIKVENGESGSKLTILAARQEHCGCYTLVVENKLGSRQAQVNLTVVD

 DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYNVEIWDTEDKVWKELATCRSTSFNVQDLLPDREYKFRVRAVNVYGTSEPSQESELTAVGEK

PEE EPKDEVEVSDDD DEKEPEVDYRTVTVNTEQKVSDVYDIEERLGS SGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKDNIRQEISIMNCLHHPKL

VQCVDAFEEKANIVMVLEI IVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLE ENAGS

LKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL LVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMK KNRLDCTQC

LQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQ KTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPINAEKLESED DDVSQAFLEAVAEEKPHVKPY

FSKTIRDLEVVEGSAARFDCKIEG GYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGE

EGGEEEEEEEE
Transcript ENSMUST00000068988
Sequence
AGAGGGGAACTCGTGTCTCTGCCTGGGTTTCCAAGAGAGCCTTTATGTGAAAGCATGTCTGGCCAGTTACCTGGGAAG ACCATGGGGGACGTGAAACTG

TTTGCCTCGTCACACATGTCTAAAACCTCCCACAGTGTGGATCCCTCGAAGGTCAGCTCCATGCCTCTCACCGAGGCCCCAGCTTTCATTCTGCCCCCTC

GGAACCTCTGCGTCAAAGAAGGAGCCACAGCCAAGTTCGAAGGGAGG - UNI34575 - GTCCGGGGCTACCCAGAGCCCCAGGTGACATGGCACAGA

AAAGGGCAAGCCATCACCAATGGTGGCCGCTTCCTGCTGGACTGTGGAGTGCGGGGGACTTTTAGTCTTGTCATCCACACTGTCCGCGAGGAGGACAAGG

GCAAATACACCTGTGAAGCTAGCAATGGCAGTGGCGCCCGCCAGGTGACCGTGGAGCTGACTGTGGAAG GGAATTCTATGAAGAAGCGTGATCAGCCTG

TTCTTTCTAAAGCCTCAGG ATTTCCAGGGGAGACTCGTCCTAGCATCTGGGGTGAGTGCCCACCAAAGTTTGCCACCAAGCTGGGCAGAGCTGTGGTCA

AAGAAGGGCAGATGGGGCGATTCTCCTGCAAGATCACTGGCCGGCCTCCACCACAGGTCACCTGGCTCAAG GGAAATGTCCCGTTGCAGCCAAGTGCCC

GTGTGTCAATGTCAGAGAAGAATGGCATGCAGATCCTGGAGATCCGTGGGGTCACTCGGGATGACCTGGGCGTGTACACCTGCATGGTGGTGAATGGGTC

AGGGAAAGCCTCCATGTCGGCGGAGCTCTCCATCCCAG GTTTGGACAATGCCGCTAG GTTGGCTGTGAGAGGAACCAAAGCCCCCAGTCCAGACATCA

GGAAGGAGGTGACCAATGGAGTCTCCAAAGACCCAGAGACTGTGGCTGAAAGTAAGAACTGTCCAAGTCCCCAGAGGAGTGGCTCCTCAGCCCGGGCCAC

CAACAGTCACCTCAAGTCCCCGCAGGAGCCCAAGCCAAAGCTGTGTGAGGATGCTCCCAGAAAGGTCCCGCAGTCCTCCATCCTGCAGAAGTCCACCAGC

ACCATCACTCTGCAGGCCTTGAAAGTCCAGCCAGAAGCGAGAGTACCAGCCATAGGGTCCTTCTCTCCTGGGGAAGACAGGAAGAGTCTGGCTGCCCCTC

AGCAAGCCACACTCCCTACCAGACAGTCTAGCCTGGGAGGTTCCGTTGGGAACAAGTTTGTTACCGGGAACATCCCCAGAGAGAGCCAAAGGGAGTCAAC

ATTCCCCAGATTTGAGAGTCAGCCCCAAAGCCAGGAAGTCACTGAAGGTCAGACAGTCAAGTTCATCTGCGAGG TTTCAGGTATACCAAAGCCTGACGT

GGGCTGGTTCCTGGAAGGCATCCCCGTGAGGAGACGGGAAGGCATCACTGAGGTTTATGAAGATGGTGTATCCCATCACCTGTGCCTGCTGAGAGCCCGG

ACGAGAGACAGTGGGAGGTACAGCTGCACAGCATCCAATAGCCTTGGCCAGGTGTCCTGCAGCTGGAGCCTGCTGGTGGACC - UNI32993 - GGCC

GAACTTGGCACAGACAGCCCCTTCATTCTCTAGTGTTCTGAAGGACAGTGTTGTCATTGAGGGCCAGGATTTTGTGCTACGGTGCTCAGTGCAGGGGACT

CCAGCACCCCGGGTCACGTGGCTGCTCAATG GACAGCCCATCCAGTTTGCTCACTCCATCTGTGAGGCAGGCGTGGCTGAGCTCCACATCCAGGATGCC

CTGCCAGAGGACCGTGGCACCTACACCTGCCTGGCTGAGAATGCCATGGGGCAGGTGTCCTGCAGCGCCACTGTCACCGTCCAAG AGAAGAAAGGTGAA

GGAGAGAGGGAACACCGTCTGTCCCCAGCTCGCAGCAAGCCCATCGCACCCATCTTCCTGCAGGGCCTCTCCGACCTCAAAGTCATGGATGGAAGCCAGG

TCACTATGACAGTCCAGGTGTCAG GGAACCCACCTCCGGAAGTCATCTGGCTTCACGACGGGAATGAGATTCAGGAGTCCGAGGACTTCCACTTCGAGC

AGAAGGGTGGCTGGCACAGCCTGTGTATCCAGGAGGTGTTCCCGGAGGACACGGGCACGTACACCTGTGAGGCCTGGAACAGTGCCGGGGAGGTCCGCAC

CCGGGCCGTCCTCACCGTGCAAG AGCCTCATGATGGCACCCAGCCCTGGTTCATCAGCAAGCCTCGTTCGGTGACAGCCACCCTGGGCCAGAGTGTCCT

CATCTCCTGCGCCATAGCTGGAGACCCCTTTCCCACCGTGCACTGGCTCCGGGATGGCAGAGCCCTCTCCAAGGACAGTGGCCACTTTGAGCTGCTCCAG

AATGAGGACGTGTTCACCCTGGTTCTAAAGAACGTGCAGCCCTGGCATGCCGGCCAGTATGAGATTCTGCTCAA GAACCGGGTTGGCGAGTGTAGTTGC

CAAGTGTCACTGATGCTTCACAACAGCCCTTCCAGAGCCCCACCACG GGGGCGGGAGCCTGCCAGCTGCGAGGGCCTCTGTGGTGGTGGAGGAGTTGGT

GCTCATGGTGATGGTGACCGTCATGGGACCCTGAGGCCCTGCTGGCCAGCAAGAGGGCAAGGTTGGCCTGAGGAGGAAGACGGAGAAGACGTGAGGGGGC

TGTTGAAGAGACGGGTGGAGACCAGGCTGCACACAGAAGAGGCCATCCGCCAGCAGGAGGTGGGGCAGCTGGATTTTCGAGACCTCCTGGGAAAGAAGGT

GAGCACCAAGACCGTCTCAGAAGACGACCTGAAGGACATCCCAGCCGAGCAGATGGATTTCCGCGCCAACCTTCAGCGGCAAGTGAAGCCAAAGACCATA

TCCGAG AAATGCTGGGTGGCCAGGGGGCGGTGCTCTGTTTCACTGTGGAAGTGGAGGAGAGCACTGGGTGTGGTGATACATACCTGGAATCCCAGCACT

CGGAAGGCCAAGGCAAGAGAATTGCAAGATCAAGGCCAGCCCAGCCAACCTTACAGGGTCCTGCTCAAATAA
Translation
  - UNI34575 -        - UNI32993 -   MDGSQVTMTVQVSG GNPPPEVIWLHDGNEIQESEDFHFEQKGGWHSLCIQEVFPEDTGTYTC

EAWNSAGEVRTRAVLTVQE EPHDGTQPWFISKPRSVTATLGQSVLISCAIAGDPFPTVHWLRDGRALSKDSGHFELLQNEDVFTLVLKNVQPWHAGQYE

ILLK KNRVGECSCQVSLMLHNSPSRAPPR RGREPASCEGLCGGGGVGAHGDGDRHGTLRPCWPARGQGWPEEEDGEDVRGLLKRRVETRLHTEEAIRQ

QEVGQLDFRDLLGKKVSTKTVSEDDLKDIPAEQMDFRANLQRQVKPKTISE KCWVARGRCSVSLWKWRRALGVVIHTWNPSTRKAKARELQDQGQPSQP

YRVLLK
Transcript ENSMUST00000023538
Sequence
AGAGGGGAACTCGTGTCTCTGCCTGGGTTTCCAAGAGAGCCTTTATGTGAAAGCATGTCTGGCCAGTTACCTGGGAAG ACCATGGGGGACGTGAAACTG

TTTGCCTCGTCACACATGTCTAAAACCTCCCACAGTGTGGATCCCTCGAAGGTCAGCTCCATGCCTCTCACCGAGGCCCCAGCTTTCATTCTGCCCCCTC

GGAACCTCTGCGTCAAAGAAGGAGCCACAGCCAAGTTCGAAGGGAGG - UNI34575 - GTCCGGGGCTACCCAGAGCCCCAGGTGACATGGCACAGA

AAAGGGCAAGCCATCACCAATGGTGGCCGCTTCCTGCTGGACTGTGGAGTGCGGGGGACTTTTAGTCTTGTCATCCACACTGTCCGCGAGGAGGACAAGG

GCAAATACACCTGTGAAGCTAGCAATGGCAGTGGCGCCCGCCAGGTGACCGTGGAGCTGACTGTGGAAG GGAATTCTATGAAGAAGCGTGATCAGCCTG

TTCTTTCTAAAGCCTCAGG ATTTCCAGGGGAGACTCGTCCTAGCATCTGGGGTGAGTGCCCACCAAAGTTTGCCACCAAGCTGGGCAGAGCTGTGGTCA

AAGAAGGGCAGATGGGGCGATTCTCCTGCAAGATCACTGGCCGGCCTCCACCACAGGTCACCTGGCTCAAG GGAAATGTCCCGTTGCAGCCAAGTGCCC

GTGTGTCAATGTCAGAGAAGAATGGCATGCAGATCCTGGAGATCCGTGGGGTCACTCGGGATGACCTGGGCGTGTACACCTGCATGGTGGTGAATGGGTC

AGGGAAAGCCTCCATGTCGGCGGAGCTCTCCATCCCAG GTTTGGACAATGCCGCTAG GTTGGCTGTGAGAGGAACCAAAGCCCCCAGTCCAGACATCA

GGAAGGAGGTGACCAATGGAGTCTCCAAAGACCCAGAGACTGTGGCTGAAAGTAAGAACTGTCCAAGTCCCCAGAGGAGTGGCTCCTCAGCCCGGGCCAC

CAACAGTCACCTCAAGTCCCCGCAGGAGCCCAAGCCAAAGCTGTGTGAGGATGCTCCCAGAAAGGTCCCGCAGTCCTCCATCCTGCAGAAGTCCACCAGC

ACCATCACTCTGCAGGCCTTGAAAGTCCAGCCAGAAGCGAGAGTACCAGCCATAGGGTCCTTCTCTCCTGGGGAAGACAGGAAGAGTCTGGCTGCCCCTC

AGCAAGCCACACTCCCTACCAGACAGTCTAGCCTGGGAGGTTCCGTTGGGAACAAGTTTGTTACCGGGAACATCCCCAGAGAGAGCCAAAGGGAGTCAAC

ATTCCCCAGATTTGAGAGTCAGCCCCAAAGCCAGGAAGTCACTGAAGGTCAGACAGTCAAGTTCATCTGCGAGG TTTCAGGTATACCAAAGCCTGACGT

GGGCTGGTTCCTGGAAGGCATCCCCGTGAGGAGACGGGAAGGCATCACTGAGGTTTATGAAGATGGTGTATCCCATCACCTGTGCCTGCTGAGAGCCCGG

ACGAGAGACAGTGGGAGGTACAGCTGCACAGCATCCAATAGCCTTGGCCAGGTGTCCTGCAGCTGGAGCCTGCTGGTGGACC - UNI32993 - GGCC

GAACTTGGCACAGACAGCCCCTTCATTCTCTAGTGTTCTGAAGGACAGTGTTGTCATTGAGGGCCAGGATTTTGTGCTACGGTGCTCAGTGCAGGGGACT

CCAGCACCCCGGGTCACGTGGCTGCTCAATG GACAGCCCATCCAGTTTGCTCACTCCATCTGTGAGGCAGGCGTGGCTGAGCTCCACATCCAGGATGCC

CTGCCAGAGGACCGTGGCACCTACACCTGCCTGGCTGAGAATGCCATGGGGCAGGTGTCCTGCAGCGCCACTGTCACCGTCCAAG AGAAGAAAGGTGAA

GGAGAGAGGGAACACCGTCTGTCCCCAGCTCGCAGCAAGCCCATCGCACCCATCTTCCTGCAGGGCCTCTCCGACCTCAAAGTCATGGATGGAAGCCAGG

TCACTATGACAGTCCAGGTGTCAG GGAACCCACCTCCGGAAGTCATCTGGCTTCACGACGGGAATGAGATTCAGGAGTCCGAGGACTTCCACTTCGAGC

AGAAGGGTGGCTGGCACAGCCTGTGTATCCAGGAGGTGTTCCCGGAGGACACGGGCACGTACACCTGTGAGGCCTGGAACAGTGCCGGGGAGGTCCGCAC

CCGGGCCGTCCTCACCGTGCAAG AGCCTCATGATGGCACCCAGCCCTGGTTCATCAGCAAGCCTCGTTCGGTGACAGCCACCCTGGGCCAGAGTGTCCT

CATCTCCTGCGCCATAGCTGGAGACCCCTTTCCCACCGTGCACTGGCTCCGGGATGGCAGAGCCCTCTCCAAGGACAGTGGCCACTTTGAGCTGCTCCAG

AATGAGGACGTGTTCACCCTGGTTCTAAAGAACGTGCAGCCCTGGCATGCCGGCCAGTATGAGATTCTGCTCAA GAACCGGGTTGGCGAGTGTAGTTGC

CAAGTGTCACTGATGCTTCACAACAGCCCTTCCAGAGCCCCACCACG GGGGCGGGAGCCTGCCAGCTGCGAGGGCCTCTGTGGTGGTGGAGGAGTTGGT

GCTCATGGTGATGGTGACCGTCATGGGACCCTGAGGCCCTGCTGGCCAGCAAGAGGGCAAGGTTGGCCTGAGGAGGAAGACGGAGAAGACGTGAGGGGGC

TGTTGAAGAGACGGGTGGAGACCAGGCTGCACACAGAAGAGGCCATCCGCCAGCAGGAGGTGGGGCAGCTGGATTTTCGAGACCTCCTGGGAAAGAAGGT

GAGCACCAAGACCGTCTCAGAAGACGACCTGAAGGACATCCCAGCCGAGCAGATGGATTTCCGCGCCAACCTTCAGCGGCAAGTGAAGCCAAAGACCATA

TCCGAGGAAGAGAGGAAGGTGCATAGCCCTCAGCAGGTTGACTTCCGGTCTGTCCTCGCCAAGAAGGGGACCCCTAAGACCCCCGTTCCTGAGAAGGCAC

CTCCAAAAGCTGCCACCCCAGACTTTCGCTCTGTGCTAGGTGGCAAGAAGAAGTCACCCTCGGAGAATGGGGGCAACAGCGCTGAGGTCTTGAATGTCAA

GGCTGGGGAAAGCCCCACACCTGCAGGCGATGCGCAGGCCATCGGGGCCCTGAAACCCGTAGGCAATGCCAAGCCTGCTGAGACCCCGAAACCTATAGGT

AATGCCAAGCCTACCGAGACCCTGAAGCCTGTGGGCAACACCAAGCCTGCCGAGACCCTGAAACCCATAGCCAACGCACAGCCTTCAGGGTCCCTGAAAC

CTGTAACCAACGCACAACCTGCTGAGCCCCAGAAGCCTGTGGGCAATGCCAAGTCTGCTGAGACCTCGAAACCAGCTGGGAAAGAAGAAGTCAAGGAGGT

AAAGAATGATGTGAACTGTAAGAAAGGGCAGGTCGGAGCCACGGGCAATGAAAAGCGACCCGAGAGCCAAGGCTCGGCCCCAGTTTTCAAGGAAAAGCTA

CAAGATGTCCATGTGGCAGAGGGGGAGAAGCTGCTACTCCAATGCCAGGTGATCTCTGATCCCCCCGCCACTGTCACCTGGTCGCTGAATGGGAAGACAC

TCAAGACCACAAAATTCATCGTCCTCGCCCAAGAAG GCTCACGTTTCTCTGTCTCCATCGAGAAGGCACTGCCTGAGGACCGAGGTTTGTACAAGTGTG

TAGCCAAGAACAGCGCTGGCCAGGCAGAGTGTTCCTGCCAAGTCACTGTGGACG ATGCTCAGACCAGTGAGAACACCAAGGCCCCGGAGATGAAATCCC

GGAGACCCAAGAGCTCTCTTCCCCCTGTGCTAGGAACAGAGA GCGACGCAACTGTGAAAAAGAAACCTGCCCCCAAGACACCCACAAAAGCAG CTATG

CCCCCTCAAATCATCCAGTTCCCCGAGGACCAGAAGGTGCGCGCAGGAGAACCTGTGGAGCTGTTTGGGAAAGTGGCTGGCACCCAGCCCATCACCTGCA

AGTGGATGAAGTTCCGAAAGCAG ATCCAGGAGAGCGAGCATATCAAGGTGGAGAATGGCGAGAGCGGCAGCAAGCTCACCATCCTGGCCGCGCGGCAGG

AGCACTGTGGCTGCTACACACTGGTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAAGTCAACCTCACGGTCGTGG ATAAGCCAGACCCCCCGGCTG

GCACACCTTGTGCTTCTGACATTCGGAGTTCCTCACTGACCCTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAATGTGGA

GATCTGGGACACAGAGGACAAGGTGTGGAAAGAGCTAGCCACGTGCCGCAGCACCTCTTTTAATGTCCAAGACCTGCTGCCTGACCGCGAGTACAAATTC

CGAGTGCGTGCAGTCAACGTCTATGGAACCAGCGAGCCAAGCCAAGAGTCCGAGCTCACAGCTGTGGGAGAGAAACCTGAAG AGCCAAAGGATGAAGTG

GAAGTGTCCGATGATG ACGAAAAGGAACCTGAGGTTGATTACCGGACGGTGACTGTTAACACTGAACAGAAAGTGTCTGATGTGTATGACATTGAAGAG

CGACTAGGATC TGGGAAGTTTGGACAAGTCTTCCGACTTGTGGAAAAGAAAACTGGAAAAATCTGGGCAGGGAAATTTTTCAAGGCCTATTCCGCCAAG

GAGAAAGACAACATCCGTCAGGAGATCAGCATCATGAACTGCCTCCACCACCCCAAGCTGGTCCAGTGTGTGGATGCCTTCGAAGAAAAGGCCAACATTG

TCATGGTTCTGGAGAT CGTGTCCGGGGGTGAGCTGTTTGAGCGTATCATTGACGAGGACTTCGAGCTGACGGAGCGGGAGTGTATCAAGTACATGAGGC

AGATCTCGGAAGGGGTGGAGTACATCCACAAGCAGGGCATTGTGCACCTGGACCTCAAGCCCGAGAACATCATGTGTGTCAACAAGACAGGCACCAGGAT

CAAGCTCATTGACTTCGGCCTGGCACGGAGACTCG AGAACGCTGGGTCTCTGAAGGTCCTCTTTGGGACCCCAGAGTTTGTGGCTCCTGAAGTGATCAA

CTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTATATTCT GGTCAGCGGACTTTCTCCCTTCATGGGTGACAATGATAA

CGAGACCTTAGCCAACGTCACTTCAGCCACCTGGGACTTCGATGACGAGGCATTCGATGAGATCTCCGATGACGCAAAGGATTTCATCAGTAACTTGCTG

AAGAAAGATATGAA AAACCGTCTGGACTGCACCCAGTGCCTTCAGCACCCATGGCTGATGAAAGACACCAAGAACATGGAGGCCAAGAAGCTGTCCAAG

GACCGGATGAAGAAATACATGGCAAGAAGGAAGTGGCAG AAAACGGGCAATGCTGTGAGAGCCATCGGGAGACTGTCCTCTATGGCAATGATCTCAGGG

CTCAGTGGCAGGAAATCTTCAACAGGGTCACCAACCAGCCCAATCAATGCGGAGAAACTAGAGTCTGAAG ACGATGTCTCCCAAGCTTTCCTGGAGGCT

GTTGCTGAGGAAAAGCCCCATGTGAAACCTTATTTCTCTAAGACCATCCGTGATCTGGAAGTCGTGGAGGGAAGCGCTGCTAGATTTGACTGCAAGATTG

AAG GATACCCAGACCCTGAGGTGGTCTGGTTCAAGGATGACCAATCAATCAGGGAGTCCCGCCACTTCCAGATAGACTACGACGAAGACGGCAACTGCT

CGCTCATCATCAGCGACGTCTGTGGGGATGATGACGCCAAGTACACCTGCAAGGCTGTCAACAGCCTCGGAGAAGCCACCTGCACTGCGGAGCTCATCGT

GGAGACCATGGAGGAAGGGGAAGGGGAGGAGGGGGGAGAGGAGGAGGAGGAGGAGGAGGAGTGAAGCCAAGCCAAACAGAAGCAGTTCCTAAGTCATTTT

AAAAAGGACTAATTCCTTAAAGCTCAAAAAAAAAAAAAAAAAAATCAAAAAAACCAAAGCTAGAAAAGGCACCTGGTGTGGTAGATGATCTAGTTAGGCT

ATTTGGAGGCTGATTCGTCAGCGACGGCGGCTGATGCCTGGGAGATATACTGATGGGCATTACTTTGAATTAGATAGCACCTTAAACACTAGTGCAGCTA

GATTCCATTTGGGAGAGATCACCAGCAACTCGTCTAATTGATTTGATTTTAGAGAGAAAATAGCTAAAAGAAATACTCACTTAGAAAAGGTCAAACATTT

CCCAGTTTAACGCACCCTGAAAAATAAAGTTGTCATCAGCCCCTTCCGCCCCGCCCCCCGCCCCCCCCTCCCCAAGCCTCCTGCTGTAGCTCAACCCAGA

TCCCCTGGAGATAGAATGTCCAGCCCCCTCCCACCCAATCCAGAGAACCCGCCTTGTCCCATCCTGCGGTGTCTCATTCTGGAAGCGGTTGAGCCAAGCT

GACTCAGGAGACACATTGCCTTCCAACTCTGCACTTTCAAGCTCTGCGTTTCTCTCCCCGCTCCAACTGCTGGGTTTCCTGGCTCTAATCCTTGCCTGAG

TTACAGCAAGGAGGACATTTATCATGTTTCTTCCATCCTGAAACCAAGTTCCCCGGCTTGTGGATGACTCTGGCTGCCTTGGGGGGGTGAGAGGTACAGG

AAGGGGGGTGTCTCCTCTCCTCTAAAATCCTTAGGAAACTAAACTTACTCCTCTGTGCAGGAGTCTGGCAGCTCCAGACATTTGCATGAGAATTCATGAA

GGAGAAAAAAAAATCCTTGCTAATGAGCTTTTCCCCCCCTTCAACCAGGATTCCTATTTGTGCTGTGAGCCAACGTCAGCCTGCACGTGCGGTAGAGTCT

TGCACCCAGACTTAAAAGCCCAGTTTGCTGAAGTGCTGGCTTTATTGGGCACTATGAAACTGATGTCAGCAACTGTAGGACTGGGGTGCTTTGGAATCTC

CTTCTAGGCAGTCTGAGTTTAATCCATCTTCATTGGCAACACTCTTCAAAGAGCTTGTCCTGCCTTCTGGGGTCCCCCTTGATCTTTCTTCCTGAATGTG

CATCACGCTTTGTAGCCCCCCCACCCCCAACCTTGACCTGCTCAGTACACTCAGACTTGCATCTTTAGCAGTTTGGTTGTTTTTTTGTTTTTTTTTTTAA

ACTTTCTTTCACTTCATTGGCACTTAATTGTTTTTCCTTATAAGACTTTTTGGAGGTCATCAACAAAGACCATAAACTGATATCCTAGTGTGCTTCCTCT

GTGTGTGCGTGTGCGTGTGTGTGTGTGTGTCTAACATTCCAAATACTTTTTTTCTTTTCCACTGTTTGTAAAGGGCAACAAATTAATATTTCAAAGGTTG

TTTTAATAGTTCCTTACAACCCGACCTTAAACTACTTCTGTGCAGTCCCACACAGTGCCGACATTAGAGAGATGACATTGCTTTGTCTTCTCAGCCGCCA

TCCTTCCTGAGCTGTTTGCTGCTGCATTGCCACTTCTTCCCCTGTTTCGCTTCTCTTAAGCAGTTTCAATATCTTTCATTATAGTCACAATATTGCCACG

GTTTATTATAATAAGGGGGTTTTAATTTGATTTAGAGCATTCAAAGTGTTTTTCATCACTTTGTGTTTATACTATAATCCTTGAGTGTATGTTGTGTGTA

TGTGTGCATGGGTGGTTATGCGTGTGTTCATAGGGTAATGCCTTCTTGGGACTGTGTTACTGTTCTCTCAGTTTATTATGCCATCCAAATGGTGGACGAG

AACGCTATGACTGTAGTTAGCTCACAATTTTTAAATAAAGGATACCACAGTGCATGGTGTTTGTTC
Translation
MSGQLPGK TMGDVKLFASSHMSKTSHSVDPSKVSSMPLTEAPAFILPPRNLCVKEGATAKFEGR - UNI34575 - VRGYPEPQVTWHRKGQAITNG

GRFLLDCGVRGTFSLVIHTVREEDKGKYTCEASNGSGARQVTVELTVEG GNSMKKRDQPVLSKASG GFPGETRPSIWGECPPKFATKLGRAVVKEGQM

GRFSCKITGRPPPQVTWLK GNVPLQPSARVSMSEKNGMQILEIRGVTRDDLGVYTCMVVNGSGKASMSAELSIPG GLDNAAR RLAVRGTKAPSPDIR

KEVTNGVSKDPETVAESKNCPSPQRSGSSARATNSHLKSPQEPKPKLCEDAPRKVPQSSILQKSTSTITLQALKVQPEARVPAIGSFSPGEDRKSLAAPQ

QATLPTRQSSLGGSVGNKFVTGNIPRESQRESTFPRFESQPQSQEVTEGQTVKFICEV VSGIPKPDVGWFLEGIPVRRREGITEVYEDGVSHHLCLLRA

RTRDSGRYSCTASNSLGQVSCSWSLLVDR - UNI32993 - RPNLAQTAPSFSSVLKDSVVIEGQDFVLRCSVQGTPAPRVTWLLNG GQPIQFAHSI

CEAGVAELHIQDALPEDRGTYTCLAENAMGQVSCSATVTVQE EKKGEGEREHRLSPARSKPIAPIFLQGLSDLKVMDGSQVTMTVQVSG GNPPPEVIW

LHDGNEIQESEDFHFEQKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTRAVLTVQE EPHDGTQPWFISKPRSVTATLGQSVLISCAIAGDPFPTVHW

LRDGRALSKDSGHFELLQNEDVFTLVLKNVQPWHAGQYEILLK KNRVGECSCQVSLMLHNSPSRAPPR RGREPASCEGLCGGGGVGAHGDGDRHGTLR

PCWPARGQGWPEEEDGEDVRGLLKRRVETRLHTEEAIRQQEVGQLDFRDLLGKKVSTKTVSEDDLKDIPAEQMDFRANLQRQVKPKTISEEERKVHSPQQ

VDFRSVLAKKGTPKTPVPEKAPPKAATPDFRSVLGGKKKSPSENGGNSAEVLNVKAGESPTPAGDAQAIGALKPVGNAKPAETPKPIGNAKPTETLKPVG

NTKPAETLKPIANAQPSGSLKPVTNAQPAEPQKPVGNAKSAETSKPAGKEEVKEVKNDVNCKKGQVGATGNEKRPESQGSAPVFKEKLQDVHVAEGEKLL

LQCQVISDPPATVTWSLNGKTLKTTKFIVLAQEG GSRFSVSIEKALPEDRGLYKCVAKNSAGQAECSCQVTVDD DAQTSENTKAPEMKSRRPKSSLPP

VLGTES SDATVKKKPAPKTPTKAA AMPPQIIQFPEDQKVRAGEPVELFGKVAGTQPITCKWMKFRKQ IQESEHIKVENGESGSKLTILAARQEHCGC

YTLVVENKLGSRQAQVNLTVVD DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYNVEIWDTEDKVWKELATCRSTSFNVQDLLPDREYKFRVR

AVNVYGTSEPSQESELTAVGEKPEE EPKDEVEVSDDD DEKEPEVDYRTVTVNTEQKVSDVYDIEERLGS SGKFGQVFRLVEKKTGKIWAGKFFKAYS

AKEKDNIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEI IVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKT

GTRIKLIDFGLARRLE ENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL LVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAK

DFISNLLKKDMK KNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQ KTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPINAEKLESED

 DDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEG GYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVN

SLGEATCTAELIVETMEEGEGEEGGEEEEEEEE

For any suggestions or comments, please send an email to unitrap@crg.es