Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022849 (Hspbap1)
Chromosomal location
Chr 16: 35770472 - 35828532 (+)
Description
Hspb associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:1913917]
RefSeq_dna
NM_175111 
RefSeq_peptide
NP_780320.2 
UniGene
Mm.401864 
MGI
MGI:1913917 
Uniprot/SWISSPROT
Q8BK58 
Human Ortholog
ENSG00000169087 (HSPBAP1)
Omim 144700 - RENAL CELL CARCINOMA 1  
UniTrap UNI38
Vector Insertion
Chr 16: 35770626 - 35787275
Public Clones GC0286 (tigem) (sanger) CSH001 (baygenomics) SYA207 (baygenomics) D008H11 (ggtc)
P093H01 (ggtc) D042A07 (ggtc) P055D10 (ggtc) P079C11 (ggtc) E021A03 (ggtc)
3SE142B03 (ggtc) P145B10 (ggtc) D053H07 (ggtc) D052D06 (ggtc) P090E10 (ggtc)
D093H04 (ggtc) D048B04 (ggtc) A037B01 (ggtc) P065D06 (ggtc) E025H02 (ggtc)
P128E09 (ggtc) P110H02 (ggtc) D078C04 (ggtc) IST14982E8 (tigm)
Private Clones OST445747 (lexicon) OST208338 (lexicon) OST40194 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5309
Vector Insertion
Chr 16: 35787462 - 35801622
Public Clones YHB170 (baygenomics) SYA280 (baygenomics) CSH354 (baygenomics) A046F08 (ggtc)
IST10062C2 (tigm) IST15060F8 (tigm)
Private Clones OST451399 (lexicon) OST350787 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21890
Vector Insertion
Chr 16: 35801805 - 35814003
Public Clones (sanger)
Private Clones OST314666 (lexicon) OST119377 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24668
Vector Insertion
Chr 16: 35814141 - 35817237
Public Clones not available
Private Clones OST210749 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3180
Vector Insertion
Chr 16: 35818849 - 35824774
Public Clones XS0223 (sanger) AM0711 (sanger) RRT285 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023555
Sequence
GGCAGAGGCGGAGGATCCTTCCTGTGTGGAAGCCGCAGATCCCGGTGAGCCCTCTCACCTGGCGCTCTCTCCATCCTCGGCGCGATAACCATGGCAGCAG

GCTGCGAGGGCATCGCGCCCCCGACCCTGGGCGAGAGAACTGTGGGGGAGGAAG - UNI38 - GTGAACCTGTCAAACCTTTTACACCAGAGAAAGCG

AAAGAGATTATAATGTCTTTACAGCAGCCTGCAATCTTCTGTAACATGGTTTTCGATTGGCCATCACGACACTGGACTGCGAAACACCTTTCGAAGGTCT

TGGAGGGCAAGCAGATACGGTTCAGAATGGGCCTGAGAGGCACAGGCACAG - UNI5309 - TTCCTCAGTATGAAACCGAATGTAGTTATGTGGATG

CGACGCTCGAGGAGTTTTTGACCTGGAACTGTGACCAGTCTAGTATCTCTGGACCATTCAAAGATTATGAACATTCTAAATTCTGGGCTTACGCTGACTA

TAAGTATTTTGTTACTCTGTTTGAGGACAAGACAGATGTTTTCCAG - UNI21890 - GAGGTGGTGTGGTCTGACTTTGGGTTTCCTGGAAGAAATG

GACAAGAAAGTACACTGTGGATCGGGTCCTTTGGAGCCCACACTCCCTGCCATCTGGACTCCTATGGTTGCAACTTAGTATTCCAGGTACAAGGAAG - 

UNI24668 - GAAAAGATGGCATCTCTTTCCTCCTGAAGATACGCCTTTCCTTTATCCAACCAGAATTCCTTACGAAGAGTCTAGTGTGTTCAGTAAAA

TCAATGTTGTCAACCCTGATTTGAAGTGTTTCCCCCAGTTCCAGAAAGCTCGAAGACATATGGTCACGTTGAGCCCAGGACAG GTTCTGTTTGTTCCCA

GACACTGGTGGCATTACGTGGAGTCTCTTGATCCTGTCACCGTCAGTATAAACTCCTGGATTGAGCTG - UNI3180 - GAAGAGGACCACCTAGCGC

GGGTGGAGGAGGCCATCACCCGCATGCTCGTGTGTACACTGAAGACTGCAGAGGACCCGCACCACCCCAGGACCTGGCTGAACCCCACTGAG GTTGAGG

AGACATCTCACGAGGTCAACAGCTGCTACTTGAACAGTGCTGTTTGTGCCTTTTTTGATCATTGTGAAAAAGCTAAAGCAGTAGAGTTGCAAGTGCTGAG

CGCAAACGGGGCGGAGCCACGTGTGCAGGAGGAGCACATGGAAGTGGAGCAGGCCCAGGGCCCGAGCCTCACATCGAGGGCTGAGAAACAGGAGGCCGTG

AGCCTGTTTGGCCCAGATCTGATCCCTGTGACACCAGCATCCGAAGAGAGAGGAGGCGCACTGGAAGGCGACAGCGAAGAATCTGTCAGCAGTAATGGAG

GACACTTTGCAGAACTGCCCTGTGCCAGGAGACAGCAAACCAGCAAAGGGGCGAGCGCATTGACGGAGCCCTTGGCCCCGAGGGGTCCTATGGCGCATTC

TCGAGTCTTCGTGTCCACAGATGACTTGCTGGACTGCCTAGTTAATCCACAAGTAACCAGGATGGTGGCCCAGCTTTTGATACAAGGAAAAAGCTGTGAT

ACTTTCTAGTAACTTTTTAATTACTTTTTAATAACTTTTAAAATATATTTTTAGAAATAATATGATATACGTGTATATTTGCTTTTTATGATTTTTTACT

TGCTCTTTGAATATGTCATGTATATACTGTATATTTTGATTACATTCATGCTGCACTGCACCTCCAGCCACTTCCAAATCCCCTTTGTCCCAAATTTTCT

CTCTTTATTTATTTACTTTTTTTTCACAACCCATTGAGTCCAGTTGCTGCTAGCCAGATACATATAATATGGCTATCCACTTAGCCCTGGTTAACCAGGG

TTGTACCACTGAAGAAAACTCAACTTTCCTTCTGGACGCAGCCATCAATAGCTCCTTAGCTAGCGCTGGGAGCCCTTGTGTCCACATTAGAATATTGACT

GGCTTGCTCTTGCACAGGCGACCACACTATAGCTGCAGAGTTCACAGGCAAACCGGTTCTGTCCTGTCCACTCCAAAAGCCATTGCTTTGCCTCACCCCT

CCCTGATCTCTGACCTGTAAAAACTCCCAGCCCCTCTTTCTCCAGCTTCTTTTTCCTTTCCCTTGGTAGGGAACAGGGGGGGTTGAAACTGGATCCAACT

ATGTAGCTCTCTCTGGCTTTCCAGGAGCTCTCAGTATAGACCAGGCTGGTCCTGAACTCTCAAGAGATCCACCAGCCTCCACTTCCAGGGTGCTGGGATC

AAAGGCGTTCGCCACCTCCCTGTTTCTCCTGGCTCTGTGTTAGCCAGCATTCACTGTACAAAGTGCTCCTTGGGTAAGGAAGGATCATCTAGAAAGGACC

CAGAAGGCAGTTTGATGTTTTGTTCATTTAGCAAAACGATAGGAGTAGGTTCACTTCCAGGCCTCACAAGCCAGGGGTCCTGGCTGGATTGAGAGTTTGT

TTTTACAGGGTCCCACTGTATACCTTAGACTGGCCTTGAATTCAAGATCCTCTGGCCCGCCTCCCCAAGCGATGGATTACAGGTTTACACTACCAAGGTT

GGTTCTCAATAGTATGATTCTAAAATAAAGGATGGAACAGGAGGTGGTGAGTTTGTACATGTTTATAAATGTGCTTTCCCCAATAAAATGCCACTGTGGT

CACCTCTTTCCAGCACATCGCTCAGTAGCCAAACTAGCTAGCTCACATTTGGGTTGGTCTTGGTTTGTTAGGTAAGACTCGGCTGCAAAGCAGTCTGAAA

GGCTGAGGTCCTCTGAAGTGGGGTAGATGGGCATGGCTACAGAATGGCCCCAGCGTTCGTTCGGCATCGCTTGAGCGTCCTGTTCAGACAATTTTGGCAG

GCTGCAGCGCTCTCCATTGTTACAAACACTAATCAAGTAAGACAGCTTTCCTCTGGTTTTAAAGGCACACAAGCATTTACGTTTCATTACTTTATGAAGC

TTCTCAGGAGGCACAGTTTCTCTGCATACATAGGGTTGTTACAGAATGGACTCAGTGTCGACTGGGCTCAGAGAAGCTGGGACGGTCTTCTGCAGGAAGT

CTTTCTTTCATGAGAAGGAAGTATCTTATTGTCCTGTAGTCTTAGAGGTTCACTGCCTCGGTCTGCTAACCCAGGCCTACGCCTAGGCCTGGAAGCTTCT

AGCCTCTGTACAATCTAATCTAAGCCTAGAACGTTTTCAGCCTCTGAGCCTTACTGCTGAATAAGCTCACCCTTTCCTAGTTCTTTCTGGCTCAAACTCC

TCTCCAGGCTGACTGAACCAATCTAGCTTCTCTCAGTTTCTCCTGAGTTGCTCTGCTTGGCTTCAGATTAACTCTGGCAATCTGTTCTGATCTTCTGGCT

CCTTCTCATTCTCTGGCTAGTTCTATCTTCACCTATGTCTAGCTTGTTCTCTCTCTGCAACCTGTCTATACTACTGTCCTGGTAAACTGCCTCATTCCCC

TCTCTGCATTGTCCCTTAAGTAGCTTCCCTTCCTCCTCTCTTCTCACAAGAGTTCGACATATTCTATTCTGTCAAGTCTTTCTCTGATTCATCACTTTGC

CACTCAATTAGACATCACTTTCAAACATGGATAGTTTCCTTCTACAAACTTAACTTTACCTACATCGTTTGAGATTAAAGGTAAGTACTAAGGACGTGTC

TATACACCATCAAAAGGGATTAAAAGCATGTACAAAGGGTTGAACCACACCACAAATAGAAACAGGCTTTTTTTTTTCCAGTTTATAACTCAAATCTCGA

TGGGGGTTCGTTCATGGTGTGATTAAATATCCTGCAACAATGTCTGTAAAAGTGGGTGGTAGGAGATGAGTCCCTGATTTTGTAGAGGGCAATTACGAGG

TCCTGGCTGATTGCAAGGGCATCCGAATGGTAAGCACCGTGAAAACGCTCATGAGCTGTTCCCACATCACCCTGCATCTCCAAGGACCACATCTGAGTCA

GGAAAATCAACTGGTAAGTACTCTGGCTCTGCATGGGCCGGCAGAGCTCAGACGCATGCTTAGTATCGTCCAATACTGAAGGACAAGTCAGTAGTGCTCA

CATACCCACGTGGTGTTCAGGAGGCATGGTGGACTCCATGAGAATGTTTTAATTTTTTTGTTTGTTTTAATACATCCATGAATGTAGCAGTATAGTTGTA

TAGTCTGGATTTTTAAAAAAATATATTTATTTTTACTTAATGTGTGAGAATGTTTGCCTGCATGAATTGATGTGTGCAGTTCCCTCACAGGTCAGAAGGG

GGCATTGGCTCCCTGGATCTTTAGTTACGGATGACCATAAACTACCCTGTGGGTGATAAGAACCAAACACGGGTCCTCTACAAGAACAGTGTTCTTAAAC

ACTGATAAGTAAGCACTCTGTCCATCTCTCCTGTCCCTGAGTTTAGGTTTGGTTGGTTGGTTGGTTGTTTTTCATTGTTATCTTTTATTATTTTACAATA

TATTTCAAAAACTGCCATTATAGTTGCCTTGAGTTCTCTGAGAGCCATAGAACACCTAGATACACATAAACATAGTCTGATATACCAACTGACCTGGACC

ATCACTAAAAAAGGGGAGGGGGCTATATATAGTTTTTAAATAAATGTGTGACAATGC
Translation
MAAGCEGIAPPTLGERTVGEEG - UNI38 - GEPVKPFTPEKAKEIIMSLQQPAIFCNMVFDWPSRHWTAKHLSKVLEGKQIRFRMGLRGTGTV - U

NI5309 - VPQYETECSYVDATLEEFLTWNCDQSSISGPFKDYEHSKFWAYADYKYFVTLFEDKTDVFQ - UNI21890 - EVVWSDFGFPGRNGQE

STLWIGSFGAHTPCHLDSYGCNLVFQVQGR - UNI24668 - RKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKCFPQFQKARRHMVTLSP

GQ VLFVPRHWWHYVESLDPVTVSINSWIEL - UNI3180 - EEDHLARVEEAITRMLVCTLKTAEDPHHPRTWLNPTE VEETSHEVNSCYLNSAVC

AFFDHCEKAKAVELQVLSANGAEPRVQEEHMEVEQAQGPSLTSRAEKQEAVSLFGPDLIPVTPASEERGGALEGDSEESVSSNGGHFAELPCARRQQTSK

GASALTEPLAPRGPMAHSRVFVSTDDLLDCLVNPQVTRMVAQLLIQGKSCDTF

For any suggestions or comments, please send an email to unitrap@crg.es