Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022865 (Cxadr)
Chromosomal location
Chr 16: 78301936 - 78360030 (+)
Description
coxsackie virus and adenovirus receptor Gene [Source:MGI (curated);Acc:Cxadr-002]
RefSeq_dna
NM_001025192 NM_009988 
RefSeq_peptide
NP_001020363.1 NP_034118.1 
UniGene
Mm.66222 Mm.410055 Mm.418623 Mm.473417 
MGI
MGI:1201679 
Uniprot/SWISSPROT
P97792 
Uniprot/SPTREMBL
Q3TV22 
Human Ortholog
ENSG00000154639 (CXADR)
Omim not available
UniTrap UNI30248
Vector Insertion
Chr 16: 78302120 - 78325401
Public Clones (sanger) D063D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34957
Vector Insertion
Chr 16: 78340997 - 78359455
Public Clones (sanger) IST14293D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023572
Sequence
TGCCGAGCTGGGGCGGGGCGCAGAGGTGCCTTCGCTGCTGCCACCGCCGGGAGCCAGTCGGGAGTGTACCAGGCTCTGGGAAAACCAGGGCTCCCAGCCG

AGATCGTTTACCTGCAAGCCACGACCCGGCCGGCAGCTACCATGGCGCGCCTACTGTGCTTCGTGCTCTTGTGCGGGATCGCGG - UNI30248 - AT

TTCACCAGTGGTTTGAGCATCACTACACCCGAACAGAGGATCGAAAAAGCCAAAGGGGAAACTGCGTATCTACCATGCAAGTTTACTCTCAGTCCCGAAG

ACCAGGGACCACTGGACATTGAATGGCTGATATCCCCGTCTGATAACCAGATAGTGGATCAAGTG ATCATTTTGTATTCTGGAGACAAAATTTATGATA

ACTACTATCCGGATCTGAAAGGACGGGTACATTTTACGAGTAACGATGTCAAGTCTGGCGACGCATCTATAAATGTGACCAACCTGCAGCTGTCGGACAT

TGGCACTTACCAGTGCAAAGTGAAGAAAGCCCCTGGGGTTGCAAATAAGAAATTCCTGCTGACCGTTCTTG TTAAGCCTTCAGGTACAAGATGCTTCGT

GGATGGATCGGAAGAGATTGGAAATGACTTCAAGCTAAAATGTGAACCCAAGGAAGGCTCCCTTCCACTACAGTTTGAATGGCAGAAACTGTCGGACTCC

CAGACAATGCCTACGCCATGGCTGGCAG AAATGACGTCACCAGTTATATCTGTGAAGAACGCCAGTTCTGAGTATTCTGGGACATACAGCTGCACGGTT

CAAAACAGAGTGGGCTCTGACCAGTGTATGCTGCGACTAGACGTTGTCCCAC CCTCCAACCGAGCCGGAACGATCGCGGGCGCCGTCATAGGGACGCTG

CTGGCCCTTGTGCTCATCGGGGCCATCCTCTTCTGCTGTCACAGGAAACGCAGAGAAGAGAAGTACGAGAAGGAAGTTCATCATGATATCAG GGAAGAT

GTGCCTCCTCCAAAGAGTCGGACATCCACTGCCAGGAGCTATATTGGCAGCAACCATTCCTCCCTGGGATCCATGTCCCCCTCTAACATGGAGGGGTATT

CCAAGACGCAGTATAACCAAGTCCCCAGTGAAGACTTTGAACGTGCGCCTCAGAGCCCGACTCTGGCACCCGCTAAGGTAGCTGCCCCTAATCTCAGTCG

AATGGGAGCGGTTCCTGTGATGATTCCTGCACAGAGCAAGGACGGGTCTATAGTATAGAACTCCGCACCTCTCTGTTCTGCTGTCCGTGGCTCGTTTCTT

CTCTTGACATATCAACATTTATTCTATTCTAAATTTTGTTAACAGTAGCCCATATATATAATATATATGTGTGTGTATGTGTATATATACACATGTGTAC

ACATATACGTATATGTACACATGTGTATATATGCATAATATATATGCATATATACGCACTTATATATGCATATATATATATGAAGAAGTTTATAAGAATC

ATACTCCATAAGATTTTTTTGGTTATTGTGAAACAATAAAGGCTTAAGAGTAATAGCATTGACCATCTGGAAAATTTGGGGTTTCTTACCAAGTTGATTT

TAAGGCCCTTATCTTATATCTGAAGAAAGATATAGCACTTTGAATATGATGTCATGGGTGAAGAAATTTGTGAGTTTACACACATCCCAAGTTGATTCTT

GAATCATCTGAAAATGATACTTCGTAGTTTCTACCATTATTTTCAGGATATCTGTCTCATTTATTGATGAACATCAGTATCTCTCAAATTGAAAAACAAA

TCCATGGAAAAACTGCTTAATGTATGAATTTGTTTTTATAGTCTGAGAATTCTAAGTGTATTTGGTTACCTGTAAAAGTAGGAGACATGACTGTTTTAGA

AATGACTAGTTTTCTTTCTAAGTCATTCCTAAACATCTATGACACGATTTCTTTCCTGTCTTTTTTTCTTTTGTTGCTGTTTGGAGATAGGGCCTCAGTG

TGTTCGTTGCCTAGGCTGGCCTCAAATCCTGATCCTTCTGCTCCCTGAATGCTGGGCTCTCAAGGCTGTATGGCTGTAGAACAGTTTCCTAAGCATTTAA

CCGGTACACTACAGAGGTAGCAGGAAGCAGGAAGCTTTAGTGCACTACAAAAGAAGCGTCCGCTACACAGAGCTGAAACCCTTGATGCTGCATGGGTCGG

GGTAGGGGGAGGATCGATGAGGACAGTGTCTGTGCCTCGCTCGGGGCCTGTGGACTGCTGCAATCCTGAGCAGGCAGGGTGAGGGTGGCAGATTTATGGG

TCTGTAGCTAAACACTGCCCTTCTACTGTAAGTGATGGTTTTGCAATTGGAAAGGAAGGAACAGAGGGAGGGAAGGGAGAGAGGGACAGAAGGAACGAAA

GGAAGGAAGAAAGGAAAGAAAACTGTTAATTCACTTATCTGGATGAGAATTCTCAAATTACTGATTTTTAAATGTGTGTTTTTGTTTTGTGGCAGACCGT

ACTGCACATTTTATGTTGTAATCTAGGCTTTTGAGTTGTAGTACGGTTCCTGGAGGCTATTTTTTTCCTCTAAGAGTCAGTGAACAAAGAGATTTGAGGC

AAGTTAAGTGTCTTCCCTGGTCCTGAATTCCAGACTTGAGCAATGTGCTTGCTGGCCCGTGGCCGCACCTGCCTCTCTCTAGCTGTCAGAAATCAAGTCT

GAGTCTTAGTTTTGTGAAAGTGACTTACTCTTAAAAGAAATTTTAAAAGGAGTAAAGGGAATACTCCTACCTGCCAAATGTATTAAATATAGTTTTCGTA

GGAAAAAAAAAGTGAATTTATTGTATATCCCTTAAGATTGTGAGGGAGTGTGTGTAGCGTGTATTGAGCCAGCATTTCCTTTATAGTAGATAAGGTCTGT

AATAAAAGATTTCATTAACTGCAAAACCTTTCCCCTAGGGAATTGGTCCCTGCTAATCTCTTCAGGTGCTGTGCTGGTAAATGCTACATTATAAATTAAT

GTTGGCATGCATTTACGACTAAGCAGAATAATGTGTATACTTTTAAATGGTGAATTTAAACTGAATGTCCATGTAATGGATTCGTGTACAGTTTTACATA

TTTGGAAGCATTTTTTTTAAACTAGGTTTAAACCTCACGTAAAATCACTTTTTATATTTGTGTTGTCTTCATCTGTGCCTTTTTAGGTAAATTTAATTTC

TACAATGACTTTCTGGTGCCTATGAGCTAGCTATCACCTACCTTGAAGGTGCTTAGAGGTGAAGGTACTGTTTTCAAAAGCACATCACTGTGGCTTTCTA

CCCTTAGAGTCCCCCTCTCGCCTTCTCTCCTCTGCTTTTCTTGATGTCACTTAAATAATACCACTGTTTATTAGGATTTAAAAGAAAGTCACACCCTCAG

TACGCTTTGACCGTGCTTCTAGTTTATAACCATAGCCATGTTTGACTTTCAGATGTTTGGCATTTTTATAAGATATTACAAGAATAAACTGGAATGCAGC

TTGTAATGGTTTCGAGAATGGTAATGAAGATTATGCTAGGTAGAAAACACTACAAAAGCAGATGTGTGGAATCTTTTCCTTTTCCTAGACTTTGTATTTA

TTTAAAGGCAAACAAAACCTAGAGTATCCCGCTATTTTTAGTCTAGATCTGTAGCAACTATAATCTGAAAGAGAAACTTGTTTAAAAAAAAAACAAACAC

TGTGAACCCCAACAGGCCTGGAGGATCAAGAATCAGAGACATAGTTGATTTTTTAGGCTTTGGCCTGCAGCGCTTCTCATTGTTAGCCTCAGTTTCCCCC

AAAGGTCAGACAAGTACTAGCAATTTCCCAGACAACCTCACTGATTTTAGTCAACCAAGGAGCAAGTACTTGCTCTAGAATCAATGTTGGTAATGGTCAA

CAGCTCATCGGCCGTGCTGGCGCATCTTAACGTAGAGCCAGTGTGAGTTCAGGGCCAGCACTGTCTTCCCAGCAGACCTTTCTGATTCCGCGCTATACAC

GAGAGACTTATTAACCCATATTGTGATGTTCCAAGAACATTAAAACATCTCTGGAGTGAAATGACACTCGTCTGTGTTCTGAATACAGAACAGTTTATGA

GTATTAATTTATTGATAATCTTAGTAGTATTTTCCTGTTAGAAAGCCTCCCCTTCTGCTCAGAGGCTGGCATCAATTTTTGTGATTTTGTAGTTACATAG

ACAAGTACTTCCTTAAATTTGAGTTATCTACCAAGGATTTATTAGTATGGAGACAGACTGAGTGTGTTTAGTGGGGAAGATCCATATAGACTATGGAAAT

GCCTAATTTCTGGCACATGTGACTGTGCACATCATCTATGATCCCTGAACTCAGAGGCACAGGACGATCATGGCTTTGAGGCCAGTAGCCAGTTCAAAGC

AAGCCTGAGCTTCCCCGAGCGACCTGGCACCGAGAGACTGGACTCAGTAGTACAGCATTTTCTCTAGAATGGGCAAAAAGAATGAGGTCTGAATCTGAAT

TCTTTTAAAGAAATGAATTTCAGACTGTACCCTGGGAATTAGATTACGTGGAGAGGCAAGTAAGCTTTTTGATTAAAAAGAACTCACTGCATGGAGTTGG

CTATTCTTTAATGTGTGACTTATGAAATAACTACTGTCTCTGTGTGTACAGCATGTAAATTTGAAGCTATGTGAATGTTCATTCATAGGTTTCTGGGGTT

TTTTTCTAAAATATTTCCAATAGTGTTTAGAGTGTTCTCAGCTGCCTTATTTCAGTGTGAACAGATAACATTCCTATTTTATGTGGTGAATGCTTTAAAT

GTGTCACTTACAGAGTAGTTGTAGAAAACAGCTGGCACGATTTTAAGTGGTTTGCGACATTATATATTATATATGTACATATATGTTTATAACATTATTG

TGTTTCATAGTATAACTGTTCTGGGCAAGTTTTAATATTTCAAATGCCTCTGGATATTCCAGCAATAAAGGCAACATGTTCTGCAGTCAAATTTCTCGTT

TGCCTACTTTGACACTAAAATAATCTGTATTTGAGCAATATTCCTTTTGAAAATATTATAGAATGAGGGAATAAATTTGTGAATTGTGGTTATTTCTCCT

TTAGGAAGGCTGACCATTTGTTTACCTTCCTTGAATGTGACCTTAAATTTTAAGTTCAGGCTTACAAACTATGTCCCAGTTTGTAATTTAGAGAATAGAG

GCCATCAGTTGGGCTTGTTGTTGATTCAGACACTAAGAAGTCTGCCAAAGACGAGCTTTGGGATTTCTGCTAATTTGTTTAATGACACAGGTGCTGAGAA

GGACCACAGTTCACCAACTGACTTATTCTTGTCCCTAATCGTGAATTTTGGCAATAAACACAGTTGTATTAAGAACACTAATTTGACACCCACATTTGCA

AAGTTATAGTGTCAGTTTCAGATTTTGTATTTCAAATATCTGGATTACATATTCAATGATGCAGATTTCAAAGTTTGTAAGAACAGTTTTGTCTAAACAC

AGAACCTTGCTCTTAGTTTTGTGACCTTGTGTACTTTTGAAATAAAATGAAGAAAGC
Translation
MARLLCFVLLCGIAD - UNI30248 - DFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQV IILYSGDKIYDNYY

PDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLV VKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQ

TMPTPWLAE EMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPP PSNRAGTIAGAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIR

 REDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSKDGSIV
Transcript ENSMUST00000114229
Sequence
TGCCGAGCTGGGGCGGGGCGCAGAGGTGCCTTCGCTGCTGCCACCGCCGGGAGCCAGTCGGGAGTGTACCAGGCTCTGGGAAAACCAGGGCTCCCAGCCG

AGATCGTTTACCTGCAAGCCACGACCCGGCCGGCAGCTACCATGGCGCGCCTACTGTGCTTCGTGCTCTTGTGCGGGATCGCGG - UNI30248 - AT

TTCACCAGTGGTTTGAGCATCACTACACCCGAACAGAGGATCGAAAAAGCCAAAGGGGAAACTGCGTATCTACCATGCAAGTTTACTCTCAGTCCCGAAG

ACCAGGGACCACTGGACATTGAATGGCTGATATCCCCGTCTGATAACCAGATAGTGGATCAAGTG ATCATTTTGTATTCTGGAGACAAAATTTATGATA

ACTACTATCCGGATCTGAAAGGACGGGTACATTTTACGAGTAACGATGTCAAGTCTGGCGACGCATCTATAAATGTGACCAACCTGCAGCTGTCGGACAT

TGGCACTTACCAGTGCAAAGTGAAGAAAGCCCCTGGGGTTGCAAATAAGAAATTCCTGCTGACCGTTCTTG TTAAGCCTTCAGGTACAAGATGCTTCGT

GGATGGATCGGAAGAGATTGGAAATGACTTCAAGCTAAAATGTGAACCCAAGGAAGGCTCCCTTCCACTACAGTTTGAATGGCAGAAACTGTCGGACTCC

CAGACAATGCCTACGCCATGGCTGGCAG AAATGACGTCACCAGTTATATCTGTGAAGAACGCCAGTTCTGAGTATTCTGGGACATACAGCTGCACGGTT

CAAAACAGAGTGGGCTCTGACCAGTGTATGCTGCGACTAGACGTTGTCCCAC CCTCCAACCGAGCCGGAACGATCGCGGGCGCCGTCATAGGGACGCTG

CTGGCCCTTGTGCTCATCGGGGCCATCCTCTTCTGCTGTCACAGGAAACGCAGAGAAGAGAAGTACGAGAAGGAAGTTCATCATGATATCAG GGAAGAT

GTGCCTCCTCCAAAGAGTCGGACATCCACTGCCAGGAGCTATATTGGCAGCAACCATTCCTCCCTGGGATCCATGTCCCCCTCTAACATGGAGGGGTATT

CCAAGACGCAGTATAACCAAGTCCCCAGTGAAGACTTTGAACGTGCGCCTCAGAGCCCGACTCTGGCACCCGCTAAG - UNI34956 - TTCAAGTAC

GCTTACAAGACCGATGGCATTACAGTGGTATAAATATGAAGGACTACTGAAGAATCTGAAGTACCATACTTCTTCCTTTATAACTCTAGTAAAGACTAAT

ATTTTGTTTTGTTTTTTGGAAAAAAAAAAAAGCACAGCACTTTTTTTTGTTTTTAGTTTTGAGCTAGGATATCATCTTGCCCAGGCTAGCATCGAATCTG

ACGCACAGCTGAGGTGAGCCGTGATGTCCTGTTGTCTGCCTCAGCCTCTCAGTTATGGGATTTCAGGCACTCCCACTACATCCAGTTTACAAGGCGGGTT

AACAGTGGCTACAGGAACACATCTGCTTTCTCTGATGGGAGAAGGCGAGTAAGTCAGATGTCCTATAACATCATTATGGGTCAAAATCCCCGTGACAAAG

GTCCCATATATACTGACTTTGATTGATAGCTGAAAGTTGTTTTATTGTATTTATATTTTCATTTAGCTACTACCAGTAAATTAGAAGTTTTTTACATGTA

TATTTTGATATGTGGCCTTTGGGGATCCTGTGTTCAATAAAAAGGTGGTTTTTTTTTTAAAATGAA
Translation
MARLLCFVLLCGIAD - UNI30248 - DFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQV IILYSGDKIYDNYY

PDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLV VKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQ

TMPTPWLAE EMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPP PSNRAGTIAGAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIR

 REDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAK - UNI34956 - FKYAYKTDGITVV

For any suggestions or comments, please send an email to unitrap@crg.es