Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022884 (Eif4a2)
Chromosomal location
Chr 16: 23107832 - 23114019 (+)
Description
eukaryotic translation initiation factor 4B Gene [Source:MGI (curated);Acc:Eif4a2-002]
RefSeq_dna
NM_013506 
RefSeq_peptide
NP_001116510.1 NP_001116509.1 NP_038534.2 
UniGene
Mm.260084 Mm.476213 
MGI
MGI:106906 
Uniprot/SWISSPROT
P10630 
Uniprot/SPTREMBL
Q8BTU6 Q52KC1 
Human Ortholog
ENSG00000156976 (EIF4A2)
Omim not available
UniTrap UNI4226
Vector Insertion
Chr 16: 23107831 - 23107894
Public Clones AQ0488 (sanger) AL0048 (sanger) AR0320 (sanger) W230C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30297
Vector Insertion
Chr 16: 23107894 - 23108657
Public Clones (sanger) D033C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4471
Vector Insertion
Chr 16: 23108660 - 23108707
Public Clones AA0058 (sanger) RST406 (baygenomics) A048E02 (ggtc) M022A05 (ggtc)
Private Clones OST435525 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI246
Vector Insertion
Chr 16: 23108925 - 23109192
Public Clones GC0394 (tigem) GC0421 (tigem) AL0340 (sanger) M016B04 (ggtc) D166A10 (ggtc)
D020B05 (ggtc) M021F04 (ggtc) Q997B10 (ggtc) PST6667-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14741
Vector Insertion
Chr 16: 23109333 - 23110057
Public Clones PST8348-NR (escells) PST7637-NR (escells) PST22639-NL (escells) PST11091-NR (escells)
PST15172-NL (escells) PST2436-NR (escells) PST13638-NL (escells) PST17888-NR (escells)
PST7640-NL (escells) PST7637-NL (escells) PST2820-NR (escells) PST10059-NR (escells)
Private Clones OST258577 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23223
Vector Insertion
Chr 16: 23110227 - 23110306
Public Clones IST15052E9 (tigm)
Private Clones OST270107 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38394
Vector Insertion
Chr 16: 23110417 - 23110652
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37508
Vector Insertion
Chr 16: 23110797 - 23111198
Public Clones PST17706-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24578
Vector Insertion
Chr 16: 23111666 - 23111889
Public Clones not available
Private Clones OST214245 (lexicon) OST121205 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12171
Vector Insertion
Chr 16: 23111970 - 23113239
Public Clones W219D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23436
Vector Insertion
Chr 16: 23112423 - 23113385
Public Clones CMHD-GT_390G2-3 (cmhd)
Private Clones OST259875 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077605
Sequence
TTTTCAGTCGGGCGCTGAGTGGGTTTTCGGATCATGTCTGGTGGCTCCGCGGATTACAACAG - UNI4226 - - UNI4471 - - UNI30297 - 

AGAACATGGCGGCCCAGAGGGAATGGACCCCGATGGTGTCATCGAG - UNI4471 - AGCAACTGGAATGAAATTGTTGATAACTTTGATGATATGAA

TTTAAAGGAGTCCCTTCTTCGAGGCATCTATGCATATGGTTTTGAGAAGCCTTCAGCTATTCAGCAAAGAGCTATTATCCCTTGTATTAAAG - UNI24

6 - GGTATGATGTGATTGCTCAAGCTCAGTCAGGTACTGGCAAGACAGCCACATTTGCTATTTCCATCCTGCAACAGTTGGAGATTGAGTTCAAGGAGA

CCCAAGCACTAGTATTGGCCCCCACCAGAGAACTGGCTCAACAG - UNI14741 - ATCCAAAAGGTAATTTTGGCTCTTGGAGATTATATGGGAGCA

ACTTGTCATGCTTGCATTGGAGGAACAAATGTTCGAAATGAAATGCAGAAGTTGCAGGCTGAAGCCCCTCACATTGTTGTTGGTACTCCAGGGAGAGTGT

TTGATATGCTAAACAGAAGATACCTTT - UNI23223 - CTCCAAAATGGATCAAAATGTTCGTTTTGGACGAAGCAGATGAAATGTTGAGCCGAGGG

TTTAAGGATCAGATCTATGAGATTTTCCAGAAATTAAATACAAGCATTCAG GTTGTGTTGCTTTCTGCCACAATGCCAACTGATGTGCTAGAAGTGACC

AAGAAATTCATGAGAGATCCAATTCGAATTCTGGTGAAGAAGGAAGAATTGACCCTTGAAGGAATTAAACAATTTTATATTAATGTTGAGCGAGAG GAG

TGGAAGCTGGACACTCTTTGTGACTTGTATGAGACTTTGACTATCACACAAGCAGTTATTTTTCTCAATACAAGGCGCAAGGTGGACTGGCTCACGGAGA

AAATGCATGCCAGGGACTTCACAGTTTCTGCTCTG CATGGTGACATGGACCAGAAGGAAAGAGATGTCATCATGAGGGAATTCCGATCAGGGTCAAGCC

GTGTTCTGATCACTACTGACTTGTTG - UNI24578 - GCCCGTGGGATTGACGTGCAACAAGTGTCCTTGGTTATAAACTACGATCTACCTACCAAT

CGTGAAAACTATATTCACAG - UNI12171 - - UNI23436 - GAGTCGATAGCGGCAGTTGATGACGAGATGGCACTCAGAAACGGCGTTGACGT

AATTTAGGACGTGGAATCATAAGCGAAACAGCACACTGTTTGAATAAAGAGCGAGTCGGTATTTATATTTGATTTTCTTTTGTCATGATTATTTGATATT

TTAAGTTGTTCCAGCCCAAGGCATTTTGTATGTTAGCATTTCTGATAGGGAGTGATAGGTGGTTTGTATTGTCTGGTACTTTGTAGGAAGGTAGAGAGCT

GTTTTGGAGGTAACACGTTTGAGTAATTTGAGTATATAACGTGTGAAAAGAAGCTGAGCAAAAAGCAGTGATAAGTTTGGGTTACCATACCAAATACTTG

CTTTCACACTGGAAAAAAAGTAAGTTTTAGAAAATAGTTAACCTTGCAGCATTTGTATTTACAGTTCCAGAAGTGCGTCGAAATGGATTGTATAACTGTT

TTCTTTTATTCCTGGTGTTTACATTTGTCCCAGGCTGACAACTGCTCCTGGCTGGCCCACTTTGGTATGGGCTTTAATTTCACCCCAAACACAATACTGT

CATCTGCTTTATTGTAATGCTCAAGGCGCCTATCTCATTTTGCAGCCAGACAAGCCTTGAATTCTTTTGGTGGCACTATCTGCAAAGGAAGATGTTTTTC

CACCTGGATATTGGTTTTATCAGCTAGTGCTCCACTTAAAAGCACGAACTATAATCCTGATAAGTAAACAGCAGCTGATGGTTAACAAGTGGATCGTCAT

ATTCAGTAGCTTTAAATAGTACTAAAGTAACTTGCTGACTGTTGGTTTCTTTCTCTTACACAGAATTGGCAGAGGGGGTCGATTTGGGAGGAAAGGTGTG

GCTATAAACTTTGTTACTGAAGAAGACAAGAGGATTCTTCGTGACATTGAGACTTTCTACAATACTACAGTGGAGGAAATGCCCATGAATGTGGCTGACC

TAATTTAATCCCTGGGATGAGATAGTTTTGAATGCAGTGCTCGCTGTTGCTGAATAGGCGATCACAACGTGCATTGTGCTTCCTTGAGAATATTTGAATC

TTGTCTCAATGCTCATAACGGATCACAAATACAGATTCTGATAGCAAAGCGACTTTAGTCCTGAGCTCTTGTGAGGAAAGGCATTGGCTTTATCCTCTTT

AGAGTTAGACTGTTGGGGGTGGGTATAAAAGATGGGGTCTGTAAAATCTTTTTTTCTTAGAAATTCATTTACTAGTTATGTAGAAATGGTTGTATTAGAT

GTTCTCTATCATTTAATAATATACTTGTGGACTAAAAGATATAAGTGCTGTATAAAATCAGCCAATTATGTTAAACTGGCATATCTGCCTTTATTGTGTT

TGTCATTAGCCTGACTAGAGAGGCCTTTAAAGTGATTTCTTTTTTTTAGAGAAAATTTGAATGCATTTTGTTGGTATTGTATTTATTCAATAAAGTATTT

AATTAGTGCTAAGTGTGAACTGGACCCTGTTGCTAAGCCTCAGCAAGCAATCATCCTAGGTAGGGTTAAACCCCCAGTAAAATTGCCATATTGCACATGT

CTTAATGAAGTTTGAATGTTAAATAAAATTGTATATTCACTTT
Translation
MSGGSADYNR - UNI4226 - - UNI4471 - - UNI30297 - REHGGPEGMDPDGVIE - UNI4471 - SNWNEIVDNFDDMNLKESLLRGI

YAYGFEKPSAIQQRAIIPCIKG - UNI246 - GYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQ - UNI14741 - IQKVI

LALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLS - UNI23223 - SPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNT

SIQ VVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVERE EWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSAL 

HGDMDQKERDVIMREFRSGSSRVLITTDLL - UNI24578 - ARGIDVQQVSLVINYDLPTNRENYIHR - UNI12171 - - UNI23436 - RS

R
Transcript ENSMUST00000023599
Sequence
CAGTCGGGCGCTGAGTGGGTTTTCGGATCATGTCTGGTGGCTCCGCGGATTACAACAG - UNI4226 - - UNI4471 - - UNI30297 - AGAA

CATGGCGGCCCAGAGGGAATGGACCCCGATGGTGTCATCGAG - UNI4471 - AGCAACTGGAATGAAATTGTTGATAACTTTGATGATATGAATTTA

AAGGAGTCCCTTCTTCGAGGCATCTATGCATATGGTTTTGAGAAGCCTTCAGCTATTCAGCAAAGAGCTATTATCCCTTGTATTAAAG - UNI246 - 

GGTATGATGTGATTGCTCAAGCTCAGTCAGGTACTGGCAAGACAGCCACATTTGCTATTTCCATCCTGCAACAGTTGGAGATTGAGTTCAAGGAGACCCA

AGCACTAGTATTGGCCCCCACCAGAGAACTGGCTCAACAG - UNI14741 - ATCCAAAAGGTAATTTTGGCTCTTGGAGATTATATGGGAGCAACTT

GTCATGCTTGCATTGGAGGAACAAATGTTCGAAATGAAATGCAGAAGTTGCAGGCTGAAGCCCCTCACATTGTTGTTGGTACTCCAGGGAGAGTGTTTGA

TATGCTAAACAGAAGATACCTTT - UNI23223 - CTCCAAAATGGATCAAAATGTTCGTTTTGGACGAAGCAGATGAAATGTTGAGCCGAGGGTTTA

AGGATCAGATCTATGAGATTTTCCAGAAATTAAATACAAGCATTCAG GTTGTGTTGCTTTCTGCCACAATGCCAACTGATGTGCTAGAAGTGACCAAGA

AATTCATGAGAGATCCAATTCGAATTCTGGTGAAGAAGGAAGAATTGACCCTTGAAGGAATTAAACAATTTTATATTAATGTTGAGCGAGAG GAGTGGA

AGCTGGACACTCTTTGTGACTTGTATGAGACTTTGACTATCACACAAGCAGTTATTTTTCTCAATACAAGGCGCAAGGTGGACTGGCTCACGGAGAAAAT

GCATGCCAGGGACTTCACAGTTTCTGCTCTG CATGGTGACATGGACCAGAAGGAAAGAGATGTCATCATGAGGGAATTCCGATCAGGGTCAAGCCGTGT

TCTGATCACTACTGACTTGTTG - UNI24578 - GCCCGTGGGATTGACGTGCAACAAGTGTCCTTGGTTATAAACTACGATCTACCTACCAATCGTG

AAAACTATATTCACAG - UNI12171 - - UNI23436 - AATTGGCAGAGGGGGTCGATTTGGGAGGAAAGGTGTGGCTATAAACTTTGTTACTGA

AGAAGACAAGAGGATTCTTCGTGACATTGAGACTTTCTACAATACTACAGTGGAGGAAATGCCCATGAATGTGGCTGACCTAATTTAA
Translation
MSGGSADYNR - UNI4226 - - UNI4471 - - UNI30297 - REHGGPEGMDPDGVIE - UNI4471 - SNWNEIVDNFDDMNLKESLLRGI

YAYGFEKPSAIQQRAIIPCIKG - UNI246 - GYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQ - UNI14741 - IQKVI

LALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLS - UNI23223 - SPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNT

SIQ VVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVERE EWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSAL 

HGDMDQKERDVIMREFRSGSSRVLITTDLL - UNI24578 - ARGIDVQQVSLVINYDLPTNRENYIHR - UNI12171 - - UNI23436 - RI

GRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI
Transcript ENSMUST00000115341
Sequence
CAGTCGGGCGCTGAGTGGGTTTTCGGATCATGTCTGGTGGCTCCGCGGATTACAACAG - UNI4226 - - UNI30297 - CAGAGAACATGGCGGC

CCAGAGGGAATGGACCCCGATGGTGTCATCGAG - UNI4471 - AGCAACTGGAATGAAATTGTTGATAACTTTGATGATATGAATTTAAAGGAGTCC

CTTCTTCGAGGCATCTATGCATATGGTTTTGAGAAGCCTTCAGCTATTCAGCAAAGAGCTATTATCCCTTGTATTAAAG - UNI246 - GGTATGATG

TGATTGCTCAAGCTCAGTCAGGTACTGGCAAGACAGCCACATTTGCTATTTCCATCCTGCAACAGTTGGAGATTGAGTTCAAGGAGACCCAAGCACTAGT

ATTGGCCCCCACCAGAGAACTGGCTCAACAG - UNI14741 - ATCCAAAAGGTAATTTTGGCTCTTGGAGATTATATGGGAGCAACTTGTCATGCTT

GCATTGGAGGAACAAATGTTCGAAATGAAATGCAGAAGTTGCAGGCTGAAGCCCCTCACATTGTTGTTGGTACTCCAGGGAGAGTGTTTGATATGCTAAA

CAGAAGATACCTTT - UNI23223 - CTCCAAAATGGATCAAAATGTTCGTTTTGGACGAAGCAGATGAAATGTTGAGCCGAGGGTTTAAGGATCAGA

TCTATGAGATTTTCCAGAAATTAAATACAAGCATTCAG GTTGTGTTGCTTTCTGCCACAATGCCAACTGATGTGCTAGAAGTGACCAAGAAATTCATGA

GAGATCCAATTCGAATTCTGGTGAAGAAGGAAGAATTGACCCTTGAAGGAATTAAACAATTTTATATTAATGTTGAGCGAGAG GAGTGGAAGCTGGACA

CTCTTTGTGACTTGTATGAGACTTTGACTATCACACAAGCAGTTATTTTTCTCAATACAAGGCGCAAGGTGGACTGGCTCACGGAGAAAATGCATGCCAG

GGACTTCACAGTTTCTGCTCTG CATGGTGACATGGACCAGAAGGAAAGAGATGTCATCATGAGGGAATTCCGATCAGGGTCAAGCCGTGTTCTGATCAC

TACTGACTTGTTG - UNI24578 - GCCCGTGGGATTGACGTGCAACAAGTGTCCTTGGTTATAAACTACGATCTACCTACCAATCGTGAAAACTATA

TTCACAG - UNI12171 - - UNI23436 - AATTGGCAGAGGGGGTCGATTTGGGAGGAAAGGTGTGGCTATAAACTTTGTTACTGAAGAAGACAA

GAGGATTCTTCGTGACATTGAGACTTTCTACAATACTACAGTGGAGGAAATGCCCATGAATGTGGCTGACCTAATTTAA
Translation
MSGGSADYNS - UNI4226 - - UNI30297 - SREHGGPEGMDPDGVIE - UNI4471 - SNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAI

QQRAIIPCIKG - UNI246 - GYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQ - UNI14741 - IQKVILALGDYMGATC

HACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLS - UNI23223 - SPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQ VVLLSAT

MPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVERE EWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSAL HGDMDQKERDV

IMREFRSGSSRVLITTDLL - UNI24578 - ARGIDVQQVSLVINYDLPTNRENYIHR - UNI12171 - - UNI23436 - RIGRGGRFGRKGV

AINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI

For any suggestions or comments, please send an email to unitrap@crg.es