Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022905 (Kpna1)
Chromosomal location
Chr 16: 35983432 - 36037217 (+)
Description
karyopherin (importin) alpha 1 Gene [Source:MGI Symbol;Acc:MGI:103560]
RefSeq_dna
NM_008465 
RefSeq_peptide
NP_032491.2 
UniGene
Mm.6952 Mm.400375 Mm.418279 
MGI
MGI:103560 
Uniprot/SWISSPROT
Q60960 
Human Ortholog
ENSG00000114030 (KPNA1)
Omim not available
UniTrap UNI9689
Vector Insertion
Chr 16: 35983595 - 36000267
Public Clones XG918 (baygenomics) D040B08 (ggtc) (ggtc) M118E10 (ggtc) D024B07 (ggtc)
P017E08 (ggtc) IST14362F7 (tigm) IST14133E2 (tigm) IST15015A3 (tigm)
IST14673A5 (tigm) IST14934E9 (tigm)
Private Clones OST318839 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22262
Vector Insertion
Chr 16: 36003037 - 36009401
Public Clones not available
Private Clones OST302104 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3037
Vector Insertion
Chr 16: 36013074 - 36019343
Public Clones XP0370 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34871
Vector Insertion
Chr 16: 36019476 - 36020241
Public Clones IST14772E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000004054
Sequence
GGGTCTCGCGGCTCTGTGAGCGGCAGCGGAGAGCGAGGCCTGGTGAGCGCCGCCGTGGTGCGCGCCGGCTGGTCAAGGTTGTGCGCAGAAGAGGCGCAGC

GGGCGGGCCAAGAGCGAGCGTCTCCCTCTTCGTAGTGGCACCGGGACCGGTCGCCTGGAGCCG - UNI9689 - AAATCATGTCCACACCAGGAAAAG

AGAACTTTCGCCTGAAAAGTTACAAGAACAAATCTCTGAATCCTGATGAGATGCGCAGGAGGAGGGAGGAAGAAGGACTGCAGTTACGGAAGCAGAAAAG

AGAAGAGCAG TTATTCAAGAGAAGAAATGTTGCTACAGCAGAAGAAGAAACAGAAGAAGAAGTTATGTCTGATGGTGGCTTTCATGAGGCCCAGATAAA

TAACATGGAGATGGCACCA - UNI22262 - GGGGGTGTCATCACCTCTGACATGACTGATATGATATTCTCGAATAGCCCAGAGCAGCAGCTCTCTG

CAACACAGAAGTTTAGGAAACTACTTTCAAAAG AACCTAATCCTCCAATTGATGAAGTCATCAACACACCAGGAGTAGTGGCCAGGTTTGTGGAGTTCC

TCAAACGAAAAGAAAATTGTACACTGCAG - UNI3037 - TTTGAATCAGCTTGGGTCCTGACAAATATTGCTTCAGGAAACTCTCTTCAGACCCGGA

ATGTGATTCAGGCAGGAGCTGTGCCTATTTTCATCGAGTTGCTTAGCTCAGAGTTTGAAGATGTCCAGGAGCAG - UNI34871 - GCAGTTTGGGCT

CTTGGCAACATTGCTGGAGATAGTACCATGTGCAGGGACTATGTCTTAAACTGCAATATCCTTCCTCCTCTTCTGCA GTTATTTTCAAAGCAAAACCGC

TTGACCATGACCCGGAATGCAGTATGGGCTTTATCTAATCTCTGTAGAGGGAAGAGCCCACCTCCAGAATTTGCTAAG GTTTCTCCCTGTCTGAATGTC

CTTTCTTGGTTACTGTTTGTCAGTGACACTGATGTACTAGCTGATGCTTGCTGGGCTCTCTCATACCTGTCAGATGGACCCAATGATAAAATCCAAGCAG

TCATCGATGCAGGAGTCTGCAGGAGGCTTGTGGAACTTCTGAT GCATAATGACTATAAAGTAGTTTCTCCTGCTTTGCGGGCTGTGGGAAACATTGTCA

CAGGGGATGATATTCAGACACAG GTAATTTTGAATTGCTCAGCTCTTCAAAGTTTATTGCATCTGCTGAGTAGCCCAAAGGAATCTATCAAAAAAGAAG

CCTGTTGGACAATCTCTAATATTACAGCTGGAAATAGGGCACAGATCCAG ACTGTGATAGATGCTAACATGTTCCCAGCTCTTATTAGTATATTGCAAA

CAGCAGAGTTCCGGACAAGGAAGGAAGCTGCTTGGGCCATCACAAATGCAACTTCTGGAGGATCAGCTGAGCAGATCAA GTACCTAGTAGAACTGGGTT

GTATCAAGCCACTCTGTGATCTCCTCACTGTCATGGATGCAAAAATTGTACAGGTTGCCCTAAATGGCTTAGAAAACATCCTGAGGCTTGGAGAACAAGA

AGCCAAACGAAACGGCTCAGGCATTAATCCTTACTGTGCTTTGATTGAGGAAGCATATG GTCTGGATAAAATTGAGTTCTTACAGAGTCATGAAAACCA

GGAGATCTATCAAAAGGCTTTTGATCTTATTGAGCATTACTTTGGGACCGAAGATGAGGACAGCAGCATCGCACCCCAGGTTGATCTTAGCCAGCAGCAG

TACATCTTCCAGCAGTGTGAAGCTCCTATGGAAGGTTTCCAGCTTTGAAGCAATCCTCTCCTTCTTGTTCCTGTGTCAGACCAGGCTATCCAGTCAAGTC

CTCTTGTGGAGCCCACAGTCCTCATGGAGCTAATCTCTCAAATGTTTTCCATAATACTGTTTGCGCTCATTTGCTTGCCTTGCGCACCTGCTCTCTTACA

CACATCTGGAAAACCTCTGGCTCTCTGTGGTGGAATACCCTTTTATTACAAGGGTAACCAGAACGGCCCACTCTCTTATGGAAAAATCCCTAAGCTTTGG

AGATCCGCACTTACATTAGAGTCATGGGAATATATACACATACTAATGTGGCTCCCTTTTTTGTGGGGGAAAAAAGAGGACTCTTCCTCATTCCGTAAAG

TGGGGAAAATGACATTGAAAGATAAAACTAAAACCTTTATCTTGAATTTTACACAACTACAAGGGAGATATTTAGACTTGTGTATACATCAGAGTACTCT

TCTCGAGTTCTTCCACAGTGAATCAACCCTTGGAGTACCTGGTGGCTTTTTCTAGCCACATTTGCATTAATCCTTATTGAGATGGGATGGTTTTCTTTCC

TCTAATGGAGTCATTTTCTTCAGATATTAAAGTTAAACCATCCAATCCCTCACCTTCAGCCTTCAGTGAATGTGCTTCTAGTTGTCAGGAATGCTGAAGA

ATTAACACTTTGACTTTTAAATGTGATCCTGGCTTGGCAGATTTCCTTAAAGCAGGAAGGAGAGAAGCATATATTAGTTTGTATGGCTTTTGCTTCTCTT

TGTTTTTGTTTCTTAGGATTTGGAAGTGGTTCAGTTTTAACGCTGGTATGAAGGCTAAAAGTCCTTAAGTAAAACCATGTTCAAAAATCCAATTAAAGAC

TAAGAACATAAAACCCATCACTTTGTTTAAACCGGTGTGACGAGAGGCTGTGTTTCTGCATTACAAATGATCCTCAGGCTTTGTGGTCCTGACCAAGGGC

CTGGTAAATTGGAGTCACCCTAGGTGCTTTTCCTCTTCGTGACTGGCAGATAACACATATTTAAATGTTACTTAGGGATTTTTTTTTCCTTTGTTGAGTG

CAGCTCGATTCTAATGTAATCATGCTGCATACATGCTTTTGCTGTGCAGCATCCTTATCTTTAAAAGCATACTAGTCTCCTCAGTGTGACCTCTAGACTA

AAAGGGCAGTGATCCAATAACCTCAGTATCCCCTGTTTTTATTTCATCTCCTACTAGTACCCTACCTCCCCTAGGAAGAACATGCCCACCTCCTGCTTAT

TTAATGATGACTGTAATGTACCTGCAAATGGCGCTTCCAGTACTGTGTTCACTGACATTTGTGCTTGGACTAGAAGGGGAAAGAAACAAGAAAAAAAGGA

TAATTGCCAAGAGAACTGCAAATGAGTTCAATGTGACTTCTCGGTGCTAGTTGGCCATCTTGGCTCAATGTTGGGACACACTATCAGAGAGAGGAGTCTT

TTTTTTTTTCCCCAATGATATTCTGTTCAAAATGAATTCTGAAGGAAAAGTTGCTCATGTCTGTTTCAGAGCATACCCTTTTAAATCTTTTTAGACTACT

CTTCTAGAATTCATCATAACCCCAAAATAGATAAAAGCTATCTAGAAGTTGCCCTGACAAGCTATTGCACATCTCTGGTAAATCCTGCTGAATGTAAGGA

ATATTCAGAGCTCTCATACCTCATCATGATGTTATTTAAGCAGCCAATTTACACGACCTGATTTACTTTGAAAAATTTGTTTCATTCAAACTAGAAAGTT

CCAGAGACAAAGGACATTTCTCAGCCAAGAGTGTGATGCATTCTTGCCCTAGTCTTTACTTGTGTCTGCTCTGGGATGGATGCTGTCTGATGTCTGTTAC

CAATGGAGCAGATACCACAAAACTAGTCAACTCCCGTCTGTCCTGTTGTTTTCTAGTGCTGCTTTGTGCTGAGAGAACATGTTAGTTTACTGAACTTGAC

CTGTACAAGACTGATTCTTTGTAATTTTAGGGTTAAATTAGGTGGTTAATTTAAAGATGAACTTTCAATGTTGCCTTTACATCACATTACAGTATCACTT

CTTTGAGAAGGTAATAGAAGCACTGATTCATAGTAAAAATCTTGTTTTTAGCTTTGACTTTTCTTGTGGCTGATTTCTTTTTAAATTGTAAATTACTGGT

AACATGTTATTTCTATAGAATGTTTTAAATTATGTACCTTCTATTGGATAGTTAAAACCTTTGCATCTTATAAAGGAGTTTGAATGAAAAGAAATAGAAA

GCACACAGAGTTGTCACCTCACCTTACCAAGAGCATACAGCTGGAACTTTTGTAGCAATATCAGGGTGGCCCAATGAGTTCAGGTCCATTAATCAGTGTG

AGCTCTTTTATCTTAAGCCTGACCAGAAGTTCATGAACTTTAAATATTCTGAACTTTGTTTTTATAGTAAAATGATTGTTTCAGTGTAAACATGGCATTC

AGCTAAACCCTGGCAAGTTCAGATGTTCTGGAACTGAGTACTTACAAAGAAGACTTTTGTTTCTTAACGCAAGTGGAATCTTAGGGGTTACTTGTAAATC

CTATTTTTAGTCTTTCACCTGGCAAAGTCTATTAATTTAATCTTTTGAAGATTTTTATCAGAAAGGTGTTACTTATTACAGAAGCATGTTAGTATTTATA

ACATAAAACCTCTTAAGGATTTTAGATAGTGATCAGGGCAAAGTGGCTTTGTTGTTTTCCTTCTCTGTCTCCTTCCAGACTTTCCAAGTATGTATTTTAT

ACTGAGAACTTTGATTTTTAAAGAAGCATTCAGAGACTTTGAGATGTAAAGGTACCTGGTACCTGAAGCACCAAAAGGTAAAGAGCCGGGTGGAGAAACA

CCCCAGAACATTCAGATGCCAGGTACAGAACACAGTTAGGAGACTTGGCTGTGGGACACGGGTTCTTGCCACCAGTCAAAGCCATCTTTAGATTGCCCTC

GTTAGCCCCCTGCTGGAAACTCTGCTGCACCAGGGTTGTTTCTTCCACACACCAGACTAAGCTGTTGGACTCCGGGTGTTTCTCAGCCTTACTGTCCTAT

AATAAATCTGAATTATTCCAGTTGCTGCTGACTATGCCTAAGAAAACATATGTAAGTATAATTTGTCAACCAAATTCTGTTGTACATGACTACCTACCGG

CAACTTTGATTGATTTCTGTAGTGCTAAATAAACATTTCAGCTGTCTGACCCCAAACGTGGGGCTGTATTG
Translation
 - UNI9689 - MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQ LFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAP - UNI2

2262 - GGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKE EPNPPIDEVINTPGVVARFVEFLKRKENCTLQ - UNI3037 - FESAWVLTNIASG

NSLQTRNVIQAGAVPIFIELLSSEFEDVQEQ - UNI34871 - AVWALGNIAGDSTMCRDYVLNCNILPPLLQ QLFSKQNRLTMTRNAVWALSNLCR

GKSPPPEFAK VSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLM MHNDYKVVSPALRAVGNIVTGDDIQTQ VILNC

SALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQ TVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIK KYLVELGCIKPLCDLLTV

MDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYG GLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAP

MEGFQL

For any suggestions or comments, please send an email to unitrap@crg.es