Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022906 (Parp9)
Chromosomal location
Chr 16: 35938556 - 35972691 (+)
Description
poly (ADP-ribose) polymerase family, member 9 Gene [Source:MGI (curated);Acc:Parp9-001]
RefSeq_dna
NM_030253 
RefSeq_peptide
NP_084529.1 
UniGene
Mm.400160 Mm.49074 
MGI
MGI:1933117 
Uniprot/SWISSPROT
Q8CAS9 
Uniprot/SPTREMBL
Q6IRT6 
Human Ortholog
ENSG00000138496 (PARP9)
Omim not available
UniTrap UNI30753
Vector Insertion
Chr 16: 35939147 - 35941118
Public Clones IST12626E3 (tigm) IST11168E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19832
Vector Insertion
Chr 16: 35941118 - 35941222
Public Clones not available
Private Clones OST379306 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29081
Vector Insertion
Chr 16: 35948441 - 35953648
Public Clones IST12632F2 (tigm) IST11357H12 (tigm) IST10279D1 (tigm)
Private Clones OST9250 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13035
Vector Insertion
Chr 16: 35960148 - 35964060
Public Clones CMHD-GT_348B10-3 (cmhd) IST10630G1 (tigm) IST12802D10 (tigm) IST14592C6 (tigm)
IST10005D4 (tigm) IST12134F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13373
Vector Insertion
Chr 16: 35964451 - 35967735
Public Clones CMHD-GT_536F10-5S (cmhd) CMHD-GT_536F10-3 (cmhd) CMHD-GT_309E11-3 (cmhd)
IST10813C3 (tigm) IST11313F11 (tigm) IST10437G12 (tigm) IST15107D9 (tigm)
IST11251D6 (tigm) IST14758E1 (tigm) IST10289D7 (tigm) IST14425E12 (tigm)
IST13956A11 (tigm) IST12716G2 (tigm) IST12242H12 (tigm) IST12100G10 (tigm)
IST14865B9 (tigm) IST10906B11 (tigm) IST11736G11 (tigm) IST11254H1 (tigm)
IST10130E9 (tigm) IST14324G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33499
Vector Insertion
Chr 16: 35967735 - 35967873
Public Clones IST12032A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13571
Vector Insertion
Chr 16: 35968313 - 35969676
Public Clones CMHD-GT_309F11-3 (cmhd) CMHD-GT_384A3-3 (cmhd) CMHD-GT_311D12-3 (cmhd) CMHD-GT_543A3-5S (cmhd)
IST10758F8 (tigm) IST12032A8 (tigm) IST12227D12 (tigm) IST14466C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30917
Vector Insertion
Chr 16: 35969852 - 35971920
Public Clones IST11803D8 (tigm) IST12912H8 (tigm) IST11729H10 (tigm) IST10256B3 (tigm)
IST11675B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13347
Vector Insertion
Chr 16: 35971920 - 35972690
Public Clones CMHD-GT_322B12-3 (cmhd) CMHD-GT_396C12-3 (cmhd) CMHD-GT_322A12-3 (cmhd) CMHD-GT_543A3-3 (cmhd)
CMHD-GT_322C6-3 (cmhd) CMHD-GT_380G11-3 (cmhd)
Private Clones OST17839 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114877
Sequence
GCAGAGCCGCCGCCTGTCTTGCTCTGCCATCTCTCAGAGCCATCACCCG - UNI19832 - - UNI30753 - AAACAGGCCACCATCTCCTCGATC

TACAGACTACACTTGGAAACACAAACAAATATAAATATCTGAAGACCCACGTGGGACCTGAAGAATGGCCTATTACATG - UNI19832 - GATACAT

GGGCGGCAGCTCCCGCCGAAAGACCAGGTATGATCGCCTCTCTCTCCCTCTCATTTAAGAAAGCCTTTGCTGAGCTCTTTCCTCAGCGCAGAAGAGGGCA

CTCAGAAGGAGACTATCCCCCCCTCAGGGGTTCAG CCAACAATTCTCTTGAAGAACATTATAGATGGCAAATTCCCATTAAACACAATGTCTTCGAAAT

TTTAAAGAGCAATGAGAGTCAGCTATGTGAAGTCCTCCAAAATAAGTTTGGATGCATCTCTACCCTGAGCTGTCCAACTCTAGCAGGGAGCAGCTCTCCT

GCTCAGAGAGTCTTCAGAAGGACCCTGATCCCTGGGATAGAGTTATCTGTCTGGAAGGATGACCTTACCAGACACGTTGTTGATGCTGTGGTGAACGCAG

CCAATGAAAACCTTTTGCATGGAAGTGGCCTGGCCGGAAGCTTGGTGAAAACTGGTGGCTTTGAAATCCAAGAAGAGAGCAAAAGAATCATTGCCAACGT

TGGTAAAATCTCAGTTGGTGGAATCGCTATCACCGGTGCGGGGAGACTTCCTTGCCATTTGATTATCCATGCGGTTGGACCTCGGTGGACAGTTACGAAC

AGCCAGACAGCTATCGAATTACTGAAATTTGCCATTAGGAACATTCTAGATTATGTCACCAAATATGATCTACGCATTAAGACAGTAGCAATTCCAGCCC

TGAGCTCTGGAATTTTCCAGTTCCCTCTGGATTTGTGTACAAGCATAATTTTAGAAACTATCCGGCTTTATTTCCAAGACAAGCAAATGTTCGGTAATTT

GAGAGAGATTCATCTGGTGAGCAATGAGGACCCCACTGTTGCGTCCTTTAAATCCGCCTCAGAAAGCATCCTAGGGAGGGACCTGAGCTCTTGGGGGGGT

CCAGAAACTGACCCTGCTTCCACCATGACTCTTCGCATCGGCCGGGGCCTGACTCTCCAGATTGTCCAAGGCTGTATTGAAATGCAAACA - UNI2908

1 - ACAGATGTAATTGTTAATTCTGGATACATGCAGGATTTTAAATCAGGACGAGTGGCACAGTCGATTCTTAGACAAGCAGGGGTTGAAATGGAAAAG

GAACTTGACAAGGTTAACCTGTCCACAGATTATCAAGAGGTGTGGGTCACAAAAGGATTTAAATTGTCCTGTCAGTATGTCTTCCATGTGGCATGGCATT

CCCAAATCAACAAATACCAG ATATTGAAAGATGCAATGAAGTCCTGTCTAGAAAAATGCCTTAAACCAGATATAAATTCCATTTCCTTTCCTGCTCTCG

GGACAGGATTGATGGATTTGAAGAAGAGTACAGCAGCTCAGATAATGTTTGAGGAAGTTTTTGCATTTGCTAAAGAGCACAAGGAAAAAACGCTAACTGT

AAAGATTGTGATCTTTCCAGTAGATGTGGAGACGTACAAG ATTTTTTATGCTGAAATGACAAAAAGGTCCAACGAGCTGAATCTCAGCGGTAATAGTG 

- UNI13035 - GTGCTTTAGCCCTGCAGTGGTCCAGTGGGGAGCAAAGAAGAGGCGGCCTTGAAGCTGGATCTCCTGCCATCAATCTCATGGGTGTAA

AAGTGGGAGAGATGTGTGAGGCCCAGGAATGGATTGAAAGGTTGCTGGTCTCCCTGGACCACCACATCATTGAGAATAATCATATTCTCTATCTTGGGAA

AAAAGAGCACGACGTGCTGTCTGAGCTCCAGACCAGCACAAGAGTCTCCATTTCAGAGACTGTCAGTCCAAGAACGGCCACTTTGGAGATTAAAGGTCCC

CAGGCTGACCTCATTGACGCAGTTATGAGGATTGAATGTATGCTGTGTGACGTTCAGGAAGAAGTGGCAGGAAAAAGGGAGAAAAATCTTTGGAGCTTGT

CAG - UNI13373 - - UNI33499 - GACAGGGGACCAACCAGCAAGAAAAACTGGATAAAATGGAAGAATCGTACACATTTCAACGATACCCAGC

ATCATTAACTCAGGAACTTCAGGACCGAAAGAAACAGTTTGAAAAGTGTGGCTTGTGGGTTGTGCAGGTATAATCAAAGAAGGCTCTGGTTTACCTAGCT

GTTAACTGGTTCTATAGCCAAAATGAAAATTCTCCTGCCAAGGACTCAGCCGCTCAGTCACCTGGAGTCTGGAATAAGACTGGGTAGAAATACAGGCCTT

GAAGAGTAGAGTTAGAATCAGGAGGCAGACATGATGTCAAGACAAGCAGAGACACAGACTCAAGATTTATGAGGAAGTGTCTACCTGTCATCGACAACTA

CCGTGGAAAGCACACGGTGTTTAGCCTGCCGTGCTACCTCTGTTTAACCCACTTTTATCTTACTAAGCCATTAGCTGTAATGGGACACATACTATGCCTG

TAGGTCATTTCTGTACCAGTGACTGCACATGCTGATGACACAGTGGAGTTGTGTGTGAAGCAGGGTAGGCATGCTGTGTGTATGCTGTCTAAATAAAGGG

CTTCTCC
Translation
 - UNI19832 - - UNI30753 - MAYYM - UNI19832 - DTWAAAPAERPGMIASLSLSFKKAFAELFPQRRRGHSEGDYPPLRGSA ANNSL

EEHYRWQIPIKHNVFEILKSNESQLCEVLQNKFGCISTLSCPTLAGSSSPAQRVFRRTLIPGIELSVWKDDLTRHVVDAVVNAANENLLHGSGLAGSLVK

TGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCHLIIHAVGPRWTVTNSQTAIELLKFAIRNILDYVTKYDLRIKTVAIPALSSGIFQFPLDLCTSII

LETIRLYFQDKQMFGNLREIHLVSNEDPTVASFKSASESILGRDLSSWGGPETDPASTMTLRIGRGLTLQIVQGCIEMQT - UNI29081 - TDVIVN

SGYMQDFKSGRVAQSILRQAGVEMEKELDKVNLSTDYQEVWVTKGFKLSCQYVFHVAWHSQINKYQ ILKDAMKSCLEKCLKPDINSISFPALGTGLMDL

KKSTAAQIMFEEVFAFAKEHKEKTLTVKIVIFPVDVETYK IFYAEMTKRSNELNLSGNSG - UNI13035 - GALALQWSSGEQRRGGLEAGSPAIN

LMGVKVGEMCEAQEWIERLLVSLDHHIIENNHILYLGKKEHDVLSELQTSTRVSISETVSPRTATLEIKGPQADLIDAVMRIECMLCDVQEEVAGKREKN

LWSLSG - UNI13373 - - UNI33499 - GQGTNQQEKLDKMEESYTFQRYPASLTQELQDRKKQFEKCGLWVVQV
Transcript ENSMUST00000023622
Sequence
CGCAGAGCCGCCGCCTGTCTTGCTCTGCCATCTCTCAGAGCCATCACCCG - UNI19832 - - UNI30753 - AAACAGGCCACCATCTCCTCGAT

CTACAGACTACACTTGGAAACACAAACAAATATAAATATCTGAAGACCCACGTGGGACCTGAAGAATGGCCTATTACATG - UNI19832 - CCAACA

ATTCTCTTGAAGAACATTATAGATGGCAAATTCCCATTAAACACAATGTCTTCGAAATTTTAAAGAGCAATGAGAGTCAGCTATGTGAAGTCCTCCAAAA

TAAGTTTGGATGCATCTCTACCCTGAGCTGTCCAACTCTAGCAGGGAGCAGCTCTCCTGCTCAGAGAGTCTTCAGAAGGACCCTGATCCCTGGGATAGAG

TTATCTGTCTGGAAGGATGACCTTACCAGACACGTTGTTGATGCTGTGGTGAACGCAGCCAATGAAAACCTTTTGCATGGAAGTGGCCTGGCCGGAAGCT

TGGTGAAAACTGGTGGCTTTGAAATCCAAGAAGAGAGCAAAAGAATCATTGCCAACGTTGGTAAAATCTCAGTTGGTGGAATCGCTATCACCGGTGCGGG

GAGACTTCCTTGCCATTTGATTATCCATGCGGTTGGACCTCGGTGGACAGTTACGAACAGCCAGACAGCTATCGAATTACTGAAATTTGCCATTAGGAAC

ATTCTAGATTATGTCACCAAATATGATCTACGCATTAAGACAGTAGCAATTCCAGCCCTGAGCTCTGGAATTTTCCAGTTCCCTCTGGATTTGTGTACAA

GCATAATTTTAGAAACTATCCGGCTTTATTTCCAAGACAAGCAAATGTTCGGTAATTTGAGAGAGATTCATCTGGTGAGCAATGAGGACCCCACTGTTGC

GTCCTTTAAATCCGCCTCAGAAAGCATCCTAGGGAGGGACCTGAGCTCTTGGGGGGGTCCAGAAACTGACCCTGCTTCCACCATGACTCTTCGCATCGGC

CGGGGCCTGACTCTCCAGATTGTCCAAGGCTGTATTGAAATGCAAACA - UNI29081 - ACAGATGTAATTGTTAATTCTGGATACATGCAGGATTT

TAAATCAGGACGAGTGGCACAGTCGATTCTTAGACAAGCAGGGGTTGAAATGGAAAAGGAACTTGACAAGGTTAACCTGTCCACAGATTATCAAGAGGTG

TGGGTCACAAAAGGATTTAAATTGTCCTGTCAGTATGTCTTCCATGTGGCATGGCATTCCCAAATCAACAAATACCAG ATATTGAAAGATGCAATGAAG

TCCTGTCTAGAAAAATGCCTTAAACCAGATATAAATTCCATTTCCTTTCCTGCTCTCGGGACAGGATTGATGGATTTGAAGAAGAGTACAGCAGCTCAGA

TAATGTTTGAGGAAGTTTTTGCATTTGCTAAAGAGCACAAGGAAAAAACGCTAACTGTAAAGATTGTGATCTTTCCAGTAGATGTGGAGACGTACAAG A

TTTTTTATGCTGAAATGACAAAAAGGTCCAACGAGCTGAATCTCAGCGGTAATAGTG - UNI13035 - GTGCTTTAGCCCTGCAGTGGTCCAGTGGG

GAGCAAAGAAGAGGCGGCCTTGAAGCTGGATCTCCTGCCATCAATCTCATGGGTGTAAAAGTGGGAGAGATGTGTGAGGCCCAGGAATGGATTGAAAGGT

TGCTGGTCTCCCTGGACCACCACATCATTGAGAATAATCATATTCTCTATCTTGGGAAAAAAGAGCACGACGTGCTGTCTGAGCTCCAGACCAGCACAAG

AGTCTCCATTTCAGAGACTGTCAGTCCAAGAACGGCCACTTTGGAGATTAAAGGTCCCCAGGCTGACCTCATTGACGCAGTTATGAGGATTGAATGTATG

CTGTGTGACGTTCAGGAAGAAGTGGCAGGAAAAAGGGAGAAAAATCTTTGGAGCTTGTCAG - UNI13373 - - UNI33499 - GACAGGGGACCA

ACCAGCAAGAAAAACTGGATAAAATGGAAGAATCGTACACATTTCAACGATACCCAGCATCATTAACTCAGGAACTTCAGGACCGAAAGAAACAGTTTGA

AAAGTGTGGCTTGTGGGTTGTGCAG - UNI13571 - - UNI33499 - GTGGAGCAGATAGACAATAAGGTGCTGCTGGCTGCCTTCCAAGAGAAG

AAGAAAATGATGGAAGAGAGGACGCCAAAGGGATCTGGGAGCCAAAGGTTGTTTCAGCAGGTCCCACATCAGTTCTGCAATACGGTGTGCAGAGTCGGCT

TCCACAGAATGTATTCGACATCCTATA - UNI13347 - - UNI30917 - ACCCAGTTTATGGAGCCGGCATATATTTCACCAAGAGCCTCAAAAA

TCTAGCAGACAAGGTCAAGAAAACCTCAAGCACAGACAAGCTAATCTATGTGTTTGAGGCAGAAGTACTCACAGGGTCCTTCTGTCAGGGTAATTCCTCA

AATATCATCCCTCCACCATTGAGTCCTGGGGCCTTAGATGTCAATGACAGCGTAGTTGACAATGTTTCCAGCCCTGAAACCATTGTTGTTTTTAATGGCA

TGCAGGCCATGCCCCTGTACTTGTGGACTTGCACACAGGATAGGACATTCTCACAGCATCCGATGTGGTCACAGGGCTACTCATCAGGACCAGGAATGGT

CTCTTCGCTGCAGTCCTGGGAATGGGTCTTAAATGGCAGCTCTGTTTAGTGTCTACATCAGTTTAACAAGCAGAAGGGGTTGAGAGAACTGACAAAATGA

TAAATAACAGGTTACCTGTTCAGAATGATGGGGTCACTAAAGGCACCGACCACACACTAGCATCATAGTGCCTTTGTCTTTACCTCTGGGCTTGACTGGG

CAGATGCCAGCTAAAACTTCCTCACTGTCTTTTCTATTTGACATCTTTCATCTCCTTTCCTATAGGTGACAGCAAGAATACTTTATATAGAACAAGGATA

TTTTTTTCAAGCCTGTTATTTTCTAAAATGATAGCACAAACTAGGACAACAGGATGATTTCAGGTTTTCTATATAATTTTATAAAGTGCTTTGGATATCC

AAATAAATCACCTTTGTCTGAGTAA
Translation
 - UNI19832 - - UNI30753 -  - UNI19832 - MFGNLREIHLVSNEDPTVASFKSASESILGRDLSSWGGPETDPASTMTLRIGRGLTLQI

VQGCIEMQT - UNI29081 - TDVIVNSGYMQDFKSGRVAQSILRQAGVEMEKELDKVNLSTDYQEVWVTKGFKLSCQYVFHVAWHSQINKYQ ILKD

AMKSCLEKCLKPDINSISFPALGTGLMDLKKSTAAQIMFEEVFAFAKEHKEKTLTVKIVIFPVDVETYK IFYAEMTKRSNELNLSGNSG - UNI1303

5 - GALALQWSSGEQRRGGLEAGSPAINLMGVKVGEMCEAQEWIERLLVSLDHHIIENNHILYLGKKEHDVLSELQTSTRVSISETVSPRTATLEIKGP

QADLIDAVMRIECMLCDVQEEVAGKREKNLWSLSG - UNI13373 - - UNI33499 - GQGTNQQEKLDKMEESYTFQRYPASLTQELQDRKKQFE

KCGLWVVQ - UNI13571 - - UNI33499 - VEQIDNKVLLAAFQEKKKMMEERTPKGSGSQRLFQQVPHQFCNTVCRVGFHRMYSTSYN - UNI

13347 - - UNI30917 - NPVYGAGIYFTKSLKNLADKVKKTSSTDKLIYVFEAEVLTGSFCQGNSSNIIPPPLSPGALDVNDSVVDNVSSPETIVV

FNGMQAMPLYLWTCTQDRTFSQHPMWSQGYSSGPGMVSSLQSWEWVLNGSSV
Transcript ENSMUST00000114878
Sequence
GAAATTCTCAGATGGAGTCGAACCGCGACCTCATCAGCGGCTGGACTCATACGAGGCTCTCTCCGCCACTGTGGGATGGAGGGAGTCTGTGGACCGCACT

CTCCCACAGACAGAGAGCCACACTCGCGTGGGCTCTCGTCGGAAGCATGCAGGGATCGGTTTGGAAACCTGCTGGTTCTACCCTTGCACCCGAGCCTTGC

CCTGTTTCCCCTGCCCCGGCTCACCTGCTTTTTTTAGGAACTTCACCTCGTAGGTGTCCGGGGCGCTGGGGCCCACGGGCTGGACAGAGCACTCCCCACC

TCCCGAGGCCCGGCTCTGGAAGTATATCTCGAGCTTCCTGTGCGCCTTGGGGATGGACTCCCGCAGCCGTACGAGTAGCGGGGACGGCGGGTCGGGACTG

GAAGCCATGGCTATCCGCGTCTGGCTCGTTTGGGGCTCAGGGGCGCTGCACAGACAGGGAAGAGCAAAGGCGAGCCCTGCCCTAAAGACCCGAGAGGCAA

AGTTTCAGTTTCGATTCCCCAGAAGGTCCCTCCTTGTTCTCCGCAGAGCCGCCGCCTGTCTTGCTCTGCCATCTCTCAGAGCCATCACCCG - UNI198

32 - - UNI30753 - AAACAGGCCACCATCTCCTCGATCTACAGACTACACTTGGAAACACAAACAAATATAAATATCTGAAGACCCACGTGGGACC

TGAAGAATGGCCTATTACATG - UNI19832 - GATACATGGGCGGCAGCTCCCGCCGAAAGACCAG CCAACAATTCTCTTGAAGAACATTATAGAT

GGCAAATTCCCATTAAACACAATGTCTTCGAAATTTTAAAGAGCAATGAGAGTCAGCTATGTGAAGTCCTCCAAAATAAGTTTGGATGCATCTCTACCCT

GAGCTGTCCAACTCTAGCAGGGAGCAGCTCTCCTGCTCAGAGAGTCTTCAGAAGGACCCTGATCCCTGGGATAGAGTTATCTGTCTGGAAGGATGACCTT

ACCAGACACGTTGTTGATGCTGTGGTGAACGCAGCCAATGAAAACCTTTTGCATGGAAGTGGCCTGGCCGGAAGCTTGGTGAAAACTGGTGGCTTTGAAA

TCCAAGAAGAGAGCAAAAGAATCATTGCCAACGTTGGTAAAATCTCAGTTGGTGGAATCGCTATCACCGGTGCGGGGAGACTTCCTTGCCATTTGATTAT

CCATGCGGTTGGACCTCGGTGGACAGTTACGAACAGCCAGACAGCTATCGAATTACTGAAATTTGCCATTAGGAACATTCTAGATTATGTCACCAAATAT

GATCTACGCATTAAGACAGTAGCAATTCCAGCCCTGAGCTCTGGAATTTTCCAGTTCCCTCTGGATTTGTGTACAAGCATAATTTTAGAAACTATCCGGC

TTTATTTCCAAGACAAGCAAATGTTCGGTAATTTGAGAGAGATTCATCTGGTGAGCAATGAGGACCCCACTGTTGCGTCCTTTAAATCCGCCTCAGAAAG

CATCCTAGGGAGGGACCTGAGCTCTTGGGGGGGTCCAGAAACTGACCCTGCTTCCACCATGACTCTTCGCATCGGCCGGGGCCTGACTCTCCAGATTGTC

CAAGGCTGTATTGAAATGCAAACA - UNI29081 - ACAGATGTAATTGTTAATTCTGGATACATGCAGGATTTTAAATCAGGACGAGTGGCACAGTC

GATTCTTAGACAAGCAGGGGTTGAAATGGAAAAGGAACTTGACAAGGTTAACCTGTCCACAGATTATCAAGAGGTGTGGGTCACAAAAGGATTTAAATTG

TCCTGTCAGTATGTCTTCCATGTGGCATGGCATTCCCAAATCAACAAATACCAG ATATTGAAAGATGCAATGAAGTCCTGTCTAGAAAAATGCCTTAAA

CCAGATATAAATTCCATTTCCTTTCCTGCTCTCGGGACAGGATTGATGGATTTGAAGAAGAGTACAGCAGCTCAGATAATGTTTGAGGAAGTTTTTGCAT

TTGCTAAAGAGCACAAGGAAAAAACGCTAACTGTAAAGATTGTGATCTTTCCAGTAGATGTGGAGACGTACAAG ATTTTTTATGCTGAAATGACAAAAA

GGTCCAACGAGCTGAATCTCAGCGGTAATAGTG - UNI13035 - GTGCTTTAGCCCTGCAGTGGTCCAGTGGGGAGCAAAGAAGAGGCGGCCTTGAA

GCTGGATCTCCTGCCATCAATCTCATGGGTGTAAAAGTGGGAGAGATGTGTGAGGCCCAGGAATGGATTGAAAGGTTGCTGGTCTCCCTGGACCACCACA

TCATTGAGAATAATCATATTCTCTATCTTGGGAAAAAAGAGCACGACGTGCTGTCTGAGCTCCAGACCAGCACAAGAGTCTCCATTTCAGAGACTGTCAG

TCCAAGAACGGCCACTTTGGAGATTAAAGGTCCCCAGGCTGACCTCATTGACGCAGTTATGAGGATTGAATGTATGCTGTGTGACGTTCAGGAAGAAGTG

GCAGGAAAAAGGGAGAAAAATCTTTGGAGCTTGTCAG - UNI13373 - - UNI33499 - GACAGGGGACCAACCAGCAAGAAAAACTGGATAAAA

TGGAAGAATCGTACACATTTCAACGATACCCAGCATCATTAACTCAGGAACTTCAGGACCGAAAGAAACAGTTTGAAAAGTGTGGCTTGTGGGTTGTGCA

G - UNI13571 - - UNI33499 - GTGGAGCAGATAGACAATAAGGTGCTGCTGGCTGCCTTCCAAGAGAAGAAGAAAATGATGGAAGAGAGGACG

CCAAAGGGATCTGGGAGCCAAAGGTTGTTTCAGCAGGTCCCACATCAGTTCTGCAATACGGTGTGCAGAGTCGGCTTCCACAGAATGTATTCGACATCCT

ATA - UNI13347 - - UNI30917 - ACCCAGTTTATGGAGCCGGCATATATTTCACCAAGAGCCTCAAAAATCTAGCAGACAAGGTCAAGAAAAC

CTCAAGCACAGACAAGCTAATCTATGTGTTTGAGGCAGAAGTACTCACAGGGTCCTTCTGTCAGGGTAATTCCTCAAATATCATCCCTCCACCATTGAGT

CCTGGGGCCTTAGATGTCAATGACAGCGTAGTTGACAATGTTTCCAGCCCTGAAACCATTGTTGTTTTTAATGGCATGCAGGCCATGCCCCTGTACTTGT

GGACTTGCACACAGGATAGGACATTCTCACAGCATCCGATGTGGTCACAGGGCTACTCATCAGGACCAGGAATGGTCTCTTCGCTGCAGTCCTGGGAATG

GGTCTTAAATGGCAGCTCTGTTTAGTGTCTACATCAGTTTAACAAGCAGAAGGGGTTGAGAGAACTGACAAAATGATAAATAACAGGTTACCTGTTCAGA

ATGATGGGGTCACTAAAGGCACCGACCACACACTAGCATCATAGTGCCTTTGTCTTTACCTCTGGGCTTGACTGGGCAGATGCCAGCTAAAACTTCCTCA

CTGTCTTTTCTATTTGACATCTTTCATCTCCTTTCCTATAGGTGACAGCAAGAATACTTTATATAGAACAAGGATATTTTTTTCAAGCCTGTTATTTTCT

AAAATGATAGCACAAACTAGGACAACAGGATGATTTCAGGTTTTCTATATAATTTTATAAAGTGCTTTGGATATCCAAATAAATCACCTTTGTCTGAGTA

A
Translation
 - UNI19832 - - UNI30753 - MAYYM - UNI19832 - DTWAAAPAERPA ANNSLEEHYRWQIPIKHNVFEILKSNESQLCEVLQNKFGCI

STLSCPTLAGSSSPAQRVFRRTLIPGIELSVWKDDLTRHVVDAVVNAANENLLHGSGLAGSLVKTGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCH

LIIHAVGPRWTVTNSQTAIELLKFAIRNILDYVTKYDLRIKTVAIPALSSGIFQFPLDLCTSIILETIRLYFQDKQMFGNLREIHLVSNEDPTVASFKSA

SESILGRDLSSWGGPETDPASTMTLRIGRGLTLQIVQGCIEMQT - UNI29081 - TDVIVNSGYMQDFKSGRVAQSILRQAGVEMEKELDKVNLSTD

YQEVWVTKGFKLSCQYVFHVAWHSQINKYQ ILKDAMKSCLEKCLKPDINSISFPALGTGLMDLKKSTAAQIMFEEVFAFAKEHKEKTLTVKIVIFPVDV

ETYK IFYAEMTKRSNELNLSGNSG - UNI13035 - GALALQWSSGEQRRGGLEAGSPAINLMGVKVGEMCEAQEWIERLLVSLDHHIIENNHILYL

GKKEHDVLSELQTSTRVSISETVSPRTATLEIKGPQADLIDAVMRIECMLCDVQEEVAGKREKNLWSLSG - UNI13373 - - UNI33499 - GQG

TNQQEKLDKMEESYTFQRYPASLTQELQDRKKQFEKCGLWVVQ - UNI13571 - - UNI33499 - VEQIDNKVLLAAFQEKKKMMEERTPKGSGS

QRLFQQVPHQFCNTVCRVGFHRMYSTSYN - UNI13347 - - UNI30917 - NPVYGAGIYFTKSLKNLADKVKKTSSTDKLIYVFEAEVLTGSFC

QGNSSNIIPPPLSPGALDVNDSVVDNVSSPETIVVFNGMQAMPLYLWTCTQDRTFSQHPMWSQGYSSGPGMVSSLQSWEWVLNGSSV
Transcript ENSMUST00000114880
Sequence
GAAATTCTCAGATGGAGTCGAACCGCGACCTCATCAGCGGCTGGACTCATACGAGGCTCTCTCCGCCACTGTGGGATGGAGGGAGTCTGTGGACCGCACT

CTCCCACAGACAGAGAGCCACACTCGCGTGGGCTCTCGTCGGAAGCATGCAGGGATCGGTTTGGAAACCTGCTGGTTCTACCCTTGCACCCGAGCCTTGC

CCTGTTTCCCCTGCCCCGGCTCACCTGCTTTTTTTAGGAACTTCACCTCGTAGGTGTCCGGGGCGCTGGGGCCCACGGGCTGGACAGAGCACTCCCCACC

TCCCGAGGCCCGGCTCTGGAAGTATATCTCGAGCTTCCTGTGCGCCTTGGGGATGGACTCCCGCAGCCGTACGAGTAGCGGGGACGGCGGGTCGGGACTG

GAAGCCATGGCTATCCGCGTCTGGCTCGTTTGGGGCTCAGGGGCGCTGCACAGACAGGGAAGAGCAAAGGCGAGCCCTGCCCTAAAGACCCGAGAGGCAA

AGTTTCAGTTTCGATTCCCCAGAAGGTCCCTCCTTGTTCTCCGCAGAGCCGCCGCCTGTCTTGCTCTGCCATCTCTCAGAGCCATCACCCG - UNI198

32 - - UNI30753 - AAACAGGCCACCATCTCCTCGATCTACAGACTACACTTGGAAACACAAACAAATATAAATATCTGAAGACCCACGTGGGACC

TGAAGAATGGCCTATTACATG - UNI19832 - GATACATGGGCGGCAGCTCCCGCCGAAAGACCAGGTATGATCGCCTCTCTCTCCCTCTCATTTAA

GAAAGCCTTTGCTGAGCTCTTTCCTCAGCGCAGAAGAGGGCACTCAGAAGGAGACTATCCCCCCCTCAGGGGTTCAG CCAACAATTCTCTTGAAGAACA

TTATAGATGGCAAATTCCCATTAAACACAATGTCTTCGAAATTTTAAAGAGCAATGAGAGTCAGCTATGTGAAGTCCTCCAAAATAAGTTTGGATGCATC

TCTACCCTGAGCTGTCCAACTCTAGCAGGGAGCAGCTCTCCTGCTCAGAGAGTCTTCAGAAGGACCCTGATCCCTGGGATAGAGTTATCTGTCTGGAAGG

ATGACCTTACCAGACACGTTGTTGATGCTGTGGTGAACGCAGCCAATGAAAACCTTTTGCATGGAAGTGGCCTGGCCGGAAGCTTGGTGAAAACTGGTGG

CTTTGAAATCCAAGAAGAGAGCAAAAGAATCATTGCCAACGTTGGTAAAATCTCAGTTGGTGGAATCGCTATCACCGGTGCGGGGAGACTTCCTTGCCAT

TTGATTATCCATGCGGTTGGACCTCGGTGGACAGTTACGAACAGCCAGACAGCTATCGAATTACTGAAATTTGCCATTAGGAACATTCTAGATTATGTCA

CCAAATATGATCTACGCATTAAGACAGTAGCAATTCCAGCCCTGAGCTCTGGAATTTTCCAGTTCCCTCTGGATTTGTGTACAAGCATAATTTTAGAAAC

TATCCGGCTTTATTTCCAAGACAAGCAAATGTTCGGTAATTTGAGAGAGATTCATCTGGTGAGCAATGAGGACCCCACTGTTGCGTCCTTTAAATCCGCC

TCAGAAAGCATCCTAGGGAGGGACCTGAGCTCTTGGGGGGGTCCAGAAACTGACCCTGCTTCCACCATGACTCTTCGCATCGGCCGGGGCCTGACTCTCC

AGATTGTCCAAGGCTGTATTGAAATGCAAACA - UNI29081 - ACAGATGTAATTGTTAATTCTGGATACATGCAGGATTTTAAATCAGGACGAGTG

GCACAGTCGATTCTTAGACAAGCAGGGGTTGAAATGGAAAAGGAACTTGACAAGGTTAACCTGTCCACAGATTATCAAGAGGTGTGGGTCACAAAAGGAT

TTAAATTGTCCTGTCAGTATGTCTTCCATGTGGCATGGCATTCCCAAATCAACAAATACCAG ATATTGAAAGATGCAATGAAGTCCTGTCTAGAAAAAT

GCCTTAAACCAGATATAAATTCCATTTCCTTTCCTGCTCTCGGGACAGGATTGATGGATTTGAAGAAGAGTACAGCAGCTCAGATAATGTTTGAGGAAGT

TTTTGCATTTGCTAAAGAGCACAAGGAAAAAACGCTAACTGTAAAGATTGTGATCTTTCCAGTAGATGTGGAGACGTACAAG ATTTTTTATGCTGAAAT

GACAAAAAGGTCCAACGAGCTGAATCTCAGCGGTAATAGTG - UNI13035 - GTGCTTTAGCCCTGCAGTGGTCCAGTGGGGAGCAAAGAAGAGGCG

GCCTTGAAGCTGGATCTCCTGCCATCAATCTCATGGGTGTAAAAGTGGGAGAGATGTGTGAGGCCCAGGAATGGATTGAAAGGTTGCTGGTCTCCCTGGA

CCACCACATCATTGAGAATAATCATATTCTCTATCTTGGGAAAAAAGAGCACGACGTGCTGTCTGAGCTCCAGACCAGCACAAGAGTCTCCATTTCAGAG

ACTGTCAGTCCAAGAACGGCCACTTTGGAGATTAAAGGTCCCCAGGCTGACCTCATTGACGCAGTTATGAGGATTGAATGTATGCTGTGTGACGTTCAGG

AAGAAGTGGCAGGAAAAAGGGAGAAAAATCTTTGGAGCTTGTCAG - UNI13373 - - UNI33499 - GACAGGGGACCAACCAGCAAGAAAAACT

GGATAAAATGGAAGAATCGTACACATTTCAACGATACCCAGCATCATTAACTCAGGAACTTCAGGACCGAAAGAAACAGTTTGAAAAGTGTGGCTTGTGG

GTTGTGCAG - UNI13571 - - UNI33499 - GTGGAGCAGATAGACAATAAGGTGCTGCTGGCTGCCTTCCAAGAGAAGAAGAAAATGATGGAAG

AGAGGACGCCAAAGGGATCTGGGAGCCAAAGGTTGTTTCAGCAGGTCCCACATCAGTTCTGCAATACGGTGTGCAGAGTCGGCTTCCACAGAATGTATTC

GACATCCTATA - UNI13347 - - UNI30917 - ACCCAGTTTATGGAGCCGGCATATATTTCACCAAGAGCCTCAAAAATCTAGCAGACAAGGTC

AAGAAAACCTCAAGCACAGACAAGCTAATCTATGTGTTTGAGGCAGAAGTACTCACAGGGTCCTTCTGTCAGGGTAATTCCTCAAATATCATCCCTCCAC

CATTGAGTCCTGGGGCCTTAGATGTCAATGACAGCGTAGTTGACAATGTTTCCAGCCCTGAAACCATTGTTGTTTTTAATGGCATGCAGGCCATGCCCCT

GTACTTGTGGACTTGCACACAGGATAGGACATTCTCACAGCATCCGATGTGGTCACAGGGCTACTCATCAGGACCAGGAATGGTCTCTTCGCTGCAGTCC

TGGGAATGGGTCTTAAATGGCAGCTCTGTTTAGTGTCTACATCAGTTTAACAAGCAGAAGGGGTTGAGAGAACTGACAAAATGATAAATAACAGGTTACC

TGTTCAGAATGATGGGGTCACTAAAGGCACCGACCACACACTAGCATCATAGTGCCTTTGTCTTTACCTCTGGGCTTGACTGGGCAGATGCCAGCTAAAA

CTTCCTCACTGTCTTTTCTATTTGACATCTTTCATCTCCTTTCCTATAGGTGACAGCAAGAATACTTTATATAGAACAAGGATATTTTTTTCAAGCCTGT

TATTTTCTAAAATGATAGCACAAACTAGGACAACAGGATGATTTCAGGTTTTCTATATAATTTTATAAAGTGCTTTGGATATCCAAATAAATCACCTTTG

TCTGAGT
Translation
 - UNI19832 - - UNI30753 - MAYYM - UNI19832 - DTWAAAPAERPGMIASLSLSFKKAFAELFPQRRRGHSEGDYPPLRGSA ANNSL

EEHYRWQIPIKHNVFEILKSNESQLCEVLQNKFGCISTLSCPTLAGSSSPAQRVFRRTLIPGIELSVWKDDLTRHVVDAVVNAANENLLHGSGLAGSLVK

TGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCHLIIHAVGPRWTVTNSQTAIELLKFAIRNILDYVTKYDLRIKTVAIPALSSGIFQFPLDLCTSII

LETIRLYFQDKQMFGNLREIHLVSNEDPTVASFKSASESILGRDLSSWGGPETDPASTMTLRIGRGLTLQIVQGCIEMQT - UNI29081 - TDVIVN

SGYMQDFKSGRVAQSILRQAGVEMEKELDKVNLSTDYQEVWVTKGFKLSCQYVFHVAWHSQINKYQ ILKDAMKSCLEKCLKPDINSISFPALGTGLMDL

KKSTAAQIMFEEVFAFAKEHKEKTLTVKIVIFPVDVETYK IFYAEMTKRSNELNLSGNSG - UNI13035 - GALALQWSSGEQRRGGLEAGSPAIN

LMGVKVGEMCEAQEWIERLLVSLDHHIIENNHILYLGKKEHDVLSELQTSTRVSISETVSPRTATLEIKGPQADLIDAVMRIECMLCDVQEEVAGKREKN

LWSLSG - UNI13373 - - UNI33499 - GQGTNQQEKLDKMEESYTFQRYPASLTQELQDRKKQFEKCGLWVVQ - UNI13571 - - UNI33

499 - VEQIDNKVLLAAFQEKKKMMEERTPKGSGSQRLFQQVPHQFCNTVCRVGFHRMYSTSYN - UNI13347 - - UNI30917 - NPVYGAGI

YFTKSLKNLADKVKKTSSTDKLIYVFEAEVLTGSFCQGNSSNIIPPPLSPGALDVNDSVVDNVSSPETIVVFNGMQAMPLYLWTCTQDRTFSQHPMWSQG

YSSGPGMVSSLQSWEWVLNGSSV

For any suggestions or comments, please send an email to unitrap@crg.es