Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022961 (Son)
Chromosomal location
Chr 16: 91647751 - 91679466 (+)
Description
Son DNA binding protein Gene [Source:MGI (curated);Acc:Son-001]
RefSeq_dna
NM_019973 NM_178880 
RefSeq_peptide
NP_064357.2 NP_849211.3 
UniGene
Mm.396020 Mm.446065 Mm.46401 
MGI
MGI:98353 
Uniprot/SWISSPROT
Q9QX47 
Uniprot/SPTREMBL
Q811G3 Q8BS91 Q8C9T5 Q8BM30 Q80TM4 
Human Ortholog
ENSG00000159140 (SON)
Omim not available
UniTrap UNI4569
Vector Insertion
Chr 16: 91648068 - 91648230
Public Clones AD0296 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17198
Vector Insertion
Chr 16: 91648230 - 91651874
Public Clones D125A06 (ggtc) P100H08 (ggtc) PST16978-NL (escells) IST12655C12 (tigm)
IST12639E5 (tigm) IST12497C6 (tigm) IST12496H9 (tigm) IST12540E8 (tigm)
IST11436F1 (tigm) IST12497H8 (tigm) IST12497B10 (tigm)
Private Clones OST447653 (lexicon) OST412372 (lexicon) OST411044 (lexicon) OST394778 (lexicon)
OST331860 (lexicon) OST303139 (lexicon) OST283874 (lexicon) OST265351 (lexicon)
OST207088 (lexicon) OST187952 (lexicon) OST139753 (lexicon) OST113625 (lexicon)
OST78393 (lexicon) OST61523 (lexicon) OST38284 (lexicon) OST33517 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25237
Vector Insertion
Chr 16: 91654855 - 91656949
Public Clones not available
Private Clones OST190795 (lexicon) OST65680 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12617
Vector Insertion
Chr 16: 91657068 - 91660826
Public Clones F061B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4682
Vector Insertion
Chr 16: 91664590 - 91664878
Public Clones AE0338 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4868
Vector Insertion
Chr 16: 91671711 - 91675645
Public Clones AE0726 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11796
Vector Insertion
Chr 16: 91675794 - 91677649
Public Clones A071D05 (ggtc) A008F03 (ggtc) A008A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114036
Sequence
GAATTGGCCGCTGCGCCTCCTCCCGAGGCATGCTGGGAGCCTGGAGGACTAGCGAGGAGTAGTTGAGAGAACGGAGCGGACGCCATGGCGGCCGACATCG

AGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCTTTCCAG - UNI4569 - - UNI17198 - TGGAAGGAGTGAA

GGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACACAGCTGCCTCTGCAAGGAGTCTCCCAAATGAAGAAATAGTGCAGA

AGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG - UNI25237 - ACTTGAAAGAGGCCTCCAGAAAAAGTAGATGC

GTATCTGTGCAAACAGATCCTACTGATGAAGTGCCCACCAAAAAGTCAAAGAAGCATAAAAAGCACAAAAACAAAAAGAAGAAAAAGAAGAAAGAAAAAG

AAAAAAAATATAAAAGACAACCAGAAGAATCTGAGTCCAAGCTGAAATCTCATCATGATGGGAATCTAGAATCTGATTCCTTCTTAAAGTTTGATTCTGA

ACCTTCAGCAGCGGCACTGGAACATCCTGTAAGAGCGTTTGGCTTATCTGAGGCCAGTGAGACCGCCTTAGTGCTGGAACCTCCAGTAGTCTCAATGGAG

GTTCAGGAGTCACACGTTCTAGAGACTCTGAAGCCAGCTACAAAAGCTGCAGAACTGTCAGTTGTGTCTACATCAGTAATCTCAGAGCAGTCTGAGCAGC

CTATGCCAGGTATGCTGGAACCATCAATGACAAAGATCCTGGATTCCTTCACAGCAGCACCAGTGCCTATGTCAACAGCGGCGCTGAAGTCACCTGAGCC

CGTTGTAACAATGTCAGTGGAATATCAGAAGTCTGTGCTGAAATCTTTGGAGACTATGCCTCCAGAGACGTCAAAGACCACGCTGGTAGAGCTTCCCATA

GCAAAAGTGGTTGAGCCATCAGAAACCCTCACGATAGTGTCAGAGACACCTACTGAGGTGCACCCTGAACCAAGCCCATCAACAATGGATTTTCCAGAGT

CATCTACAACTGACGTGCAAAGATTGCCAGAGCAGCCTGTAGAAGCACCATCGGAGATTGCAGATTCATCCATGACAAGACCTCAGGAGTCACTGGAGCT

GCCTAAGACCACAGCGGTGGAGCTGCAGGAGTCGACGGTGGCCTCAGCTCTGGAGTTGCCGGGGCCACCTGCGACCTCCATTCTGGAGTTGCAGGGGCCC

CCTGTGACTCCAGTGCCAGAGTTGCCTGGGCCCTCTGCCACCCCAGTGCCAGAGTTGTCAGGGCCCCTTTCTACCCCAGTGCCTGAGTTGCCAGGGCCCC

CTGCGACAGTGGTCCCTGAGTTGCCGGGGCCCTCTGTGACACCAGTGCCACAGTTGTCGCAGGAATTGCCAGGGCCTCCAGCACCATCCATGGGGTTGGA

GCCACCACAGGAGGTACCAGAGCCACCTGTGATGGCACAGGAGTTATCAGGGGTGCCTGCAGTGTCGGCAGCGATAGAGTTGACAGGGCAACCTGCAGTA

ACAGTAGCAATGGAGTTGACCGAACAACCTGTGACGACGACAGAGTTCGAGCAGCCTGTGGCGATGACAACGGTGGAGCATCCTGGGCATCCTGAGGTGA

CAACAGCTACAGGGTTGCTGGGGCAGCCAGAGGCAGCAATGGTGCTGGAGTTGCCAGGCCAGCCAGTGGCAACCACAGCGCTGGAGTTGTCTGGGCAGCC

TTCGGTGACTGGGGTGCCAGAGTTGTCAGGGCTGCCTTCGGCAACTAGGGCACTGGAGTTGTCAGGGCAGTCTGTGGCAACTGGGGCATTAGAGTTGCCT

GGTCAGCTCATGGCAACTGGGGCACTGGAGTTTTCGGGGCAGTCTGGGGCAGCTGGAGCACTGGAGCTTTTGGGGCAGCCCCTAGCAACGGGGGTGCTAG

AGTTACCAGGGCAGCCTGGAGCGCCAGAGTTGCCTGGGCAGCCTGTGGCAACTGTGGCGCTGGAGATCTCTGTTCAGTCTGTGGTGACAACATCGGAGCT

GTCAACGATGACCGTGTCGCAGTCCCTGGAGGTGCCCTCGACGACAGCGCTGGAATCCTATAATACGGTAGCACAGGAGCTGCCTACTACATTGGTGGGG

GAGACTTCTGTAACAGTAGGAGTGGACCCCTTGATGGCCCAAGAATCCCATATGCTAGCTTCTAACACCATGGAGACCCATATGTTAGCATCCAATACCA

TGGACTCCCAGATGCTAGCATCCAACACTATGGATTCTCAGATGCTAGCATCCAATACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCA

GATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCAACTAGCACCATGGACTCCCAGATGTTAGCAACTAGCTCTATGGACTCCCAGATGTTAGCA

ACTAGCTCTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCTCCA

TGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGTTCCATGGACTCCCA

GATGTTAGCATCTGGTGCTATGGATTCTCAGATGTTAGCTTCTGGCACTATGGATGCTCAGATGTTAGCATCTGGTACTATGGATGCCCAAATGTTAGCA

TCTAGTACCCAGGATTCTGCTATGATGGGTTCAAAGTCTCCTGATCCCTATAGGTTAGCTCAGGATCCTTACAGATTAGCTCAGGATCCCTATAGGTTGG

GTCATGACCCCTACAGGTTAGGCCATGATGCTTACAGGTTAGGACAAGACCCTTATAGATTAGGCCATGATCCCTACAGACTAACTCCGGATCCCTATAG

GGTATCACCTAGGCCCTATAGAATAGCACCCAGGTCCTATAGGATAGCACCTAGGCCATACAGGTTAGCACCTAGACCCTTGATGTTAGCATCTAGACGT

TCTATGATGATGTCCTATGCTGCAGAACGTTCCATGATGTCATCTTATGAGCGCTCTATGATGTCTTATGAACGCTCTATGATGTCCCCTATGGCTGAAC

GCTCTATGATGTCGGCCTATGAGCGCTCCATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGAGCGTTCTATGATGTCAGCTTATGAGCG

CTCTATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGATCGATCCATGATGTCCATGGGTGCCGACCGGTCTATGATGTCATCGTACTCT

GCAGCTGACCGGTCTATGATGTCATCGTACTCTGCAGCTGATCGATCAATGATGTCATCTTACACTGATCGATCAATGATGTCTATGGCAGCTGATTCTT

ACACTGATTCTTATACTGATTCCTATACGGAGGCATATATGGTGCCACCTTTGCCTCCTGAAGAGCCCCCAACAATGCCACCATTGCCACCCGAGGAACC

ACCAATGACACCCCCATTACCTCCTGAGGAACCACCAGAGGGTCCAGCATTATCAACAGAGCAGTCAGCATTAACAGCTGACAATACTTGGTCTACAGAG

GTGACATTATCTACTGGAGAATCTCTATCACAGCCTGAGCCTCCTGTGAGTCAAAGTGAGATTTCAGAGCCTATGGCAGTACCTGCTAATTATTCAATGT

CAGAATCAGAAACTTCAATGTTAGCATCAGAGGCTGTTATGACTGTTCCAGAACCTGCACGAGAGCCCGAGTCTTCAGTTACATCAGCACCAGTTGAGTC

TGCTGTAGTAGCAGAACATGAAATGGTTCCAGAGAGACCGATGACTTACATGGTTTCTGAGACTACCATGTCAGTCGAGCCAGCTGTGTTAACATCAGAG

GCTTCTGTTATATCAGAGACATCAGAAACATATGATTCCATGAGACCTTCAGGACATGCTATCTCAGAGGTAACTATGTCACTCTTGGAGCCAGCAGTAA

CTATTTCACAGCCAGCAGAGAACAGTCTAGAGCTCCCATCCATGACTGTCCCAGCACCTTCTACTATGACTACCACAGAATCTCCAGTTGTTGCTGTCAC

AGAAATTCCTCCTGTGGCTGTCCCAGAACCTCCCATTATGGCTGTTCCAGAACTCCCCACCATGGCTGTAGTAAAAACCCCCGCTGTGGCTGTCCCAGAA

CCTCTTGTGGCTGCTCCAGAGCCTCCTACCATGGCTACTCCAGAACTTTGCTCCTTATCTGTCTCAGAACCTCCTGTGGCTGTCTCGGAGCTTCCAGCTT

TGGCTGACCCAGAGCATGCTATCACTGCAGTGTCAGGTGTTTCTTCCCTGGAGCCTTCTGTGCCTATTTTGGAACCAGCAGTATCAGTCCTTCAACCTGT

TATGATTGTTTCAGAACCGTCTGTTCCTGTCCAGGAACCTACCGTGGCAGTGTCAGAACCTGCTGTCATAGTCTCAGAGCACACGCAAATAACATCACCT

GAGATGGCTGTAGAGTCTTCACCAGTAATAGTGGACTCTAGTGTTATGTCATCACAGATTATGAAAGGAATGAATTTGCTTGGTGGTGATGAAAATCTTG

GTCCAGAGGTTGGCATGCAGGAGACTCTGTTGCATCCAGGTGAAGAGCCACGTGATGGAGGACACTTGAAAAGTGACTTGTATGAAAATGAGTATGATAG

AAATGCAGACCTTACTGTAAACAGTCATTTAATTGTTAAAGATGCAGAGCATAACACAGTGTGTGCTACTACCGTTGGTCCTGTTGGTGAAGCAAGTGAA

GAGAAAATTTTGCCTATTAGTGAGACTAAGGAAATCACAGAATTGGCTACCTGTGCTGCCGTCAGCGAAGCTGACATAGGCAGAAGTCTGTCTTCTCAGC

TTGCTCTGGAGCTGGATACAGTAGGAACTAGTAAGGGGTTTGAATTTGTCACTGCATCTGCACTCATTTCAGAGAGTAAATATGATGTTGAAGTATCTGT

AACTACTCAAGATACTGAACATGACATGGTAATTTCCACCAGCCCCAGTGGTGGCAGCGAAGCAGACATAGAGGGACCTTTGCCTGCTAAAGACATTCAT

CTTGATTTGCCATCAACTAATTTTGTTTGTAAGGATGTAGAAGACTCGTTACCTATCAAAGAGAGTGCCCAGGCAGTGGCAGTGGCTCTTAGCCCTAAAG

AGAGCAGTGAAGATACAGAAGTACCTCTTCCCAATAAAGAAATAGTTCCTGAGTCAGGATATTCTGCCAGCATTGATGAAATTAATGAAGCTGACTTAGT

GAGACCATTACTTCCTAAGGACATGGAGCGTCTTACAAGCCTTAGAGCTGGCATTGAAGGACCTTTACTTGCTAGTGAGGTTGAACGTGACAAGTCAGCT

GCCAGTCCAGTTGTAATTAGCATACCAGAAAGAGCTTCAGAGTCATCTTCAGAGGAAAAGGATGATTATGAAATTTTTGTCAAAGTTAAGGACACACATG

AAAAAAGCAAGAAAAACAAAAACCGTGACAAAGGTGAGAAGGAGAAGAAAAGGGACTCTTCATTACGGTCTCGGAGTAAGCGTTCCAAGTCTTCTGAACA

TAAGTCACGCAAGCGCACCAGTGAGTCGCGTTCTAGAGCAAGGAAGAGGTCGTCCAAGTCCAAATCTCACCGTTCTCAGACACGGTCACGGTCACGCTCA

AGACGCAGGAGGAGGAGTAGCCGATCAAGATCTAAGTCTAGAGGAAGACGGTCTGTATCAAAAGAGAAACGCAAAAGGTCTCCAAAGCATAGATCCAAGT

CCAGGGAAAGGAAAAGGAAAAGATCAAGCTCACGAGACAACCGGAAAGCAGCTCGAGCTCGGAGTCGAACCCCGAGTCGGCGGAGTAGGAGCCACACTCC

TAGTCGGAGGAGACGGTCTAGATCTGTTGGTAGAAGGAGAAGTTTTAGCATTTCCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCAGAACCCCC

AGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGTCGGAGAAGATCACGGTCTGCGGTAAGAAGAC

GAAGCTTCAGTATATCACCGGTCAGATTAAGGCGATCAAGAACACCTTTGAGAAGAAGGTTTAGTAGATCTCCCATTCGGCGGAAAAGATCCAGGTCTTC

AGAAAGAGGCAGATCGCCCAAACGTCTAACAGATTTGG - UNI12617 - ATAAGGCTCAATTACTTGAAATAGCCAAAGCTAATGCAGCTGCCATGT

GTGCTAAGGCTGGTGTTCCTTTACCACCAAACCTAAAGCCTGCACCTCCACCTACAATAGAAGAGAAAGTTGCTAAAAAGTCTGGAGGAGCTACCATAGA

AGAACTAACTGAG TTTTAGAAGCCAAACTGACTGAGGAGTGGAACGGTTCGTGTGAATGGAGGAGGTGTTGAGTGAGCAACACGCAGAAGCTCGCCTAC

AGTTTCGTTTCCATTCACGACGTGTTCACTGATCGCCAAGAGTGTACTGCATATACGCAAAGACACAGACAATCTTCAGAAATGATCTTTTGCCACCGGA

GCTTGGAAATTAATGAGAATAGCTGGCCATTGCCTGAAAGGAACTTCTTTCGCATCAACATTTCGGGTTTTGGCTGTTTGGTACCAGCCATTGGCGATAA

TGGCCGGCCATTATCAGTTCTTCCTGCGGTTCGGGTTTTGGCAGTAACATATTTTAAATATACTTATTTTTGTTTTTAAAAATTTGATCTTTTGAAATTG

AGGCTTTTGGGGGAAGCTTTGTTTTACTTTAATATTTTTTTGTGTGTGTGAGGGAAGACGCTGAAATATTGCTGCTAGGATCCAGAAATAACACAGTTTC

ATATGCTGAAACTTGTTATTGGCTGGCCTTATGCCAGCCTGCCACTGTCAACATACTCTGTTCCATTGGTTACATGCTTGATAGATACACTCTTGTGTTT

TTGGCTAATTGAGCTTTTTAATTCTATTGTAATATTTTCAATTGATAATAGATGTGATAAATTCTGCTTGTATAGACAGGTCTACTAAAATTTACTCTTA

ACCTTTTTATAAATGGAATCTGTCCTTTGCTTCTGAGAAAGGAATTGACTTTCTGTGTTGGACTGCATCAATTGTGCCCTCTCCATCATGCCTTATTTTC

CATTCTTAAGTTACAGTCCTGAAATAAATTT
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI25237 - DLKEASRKSRCVSVQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNLESDSFLKFDS

EPSAAALEHPVRAFGLSEASETALVLEPPVVSMEVQESHVLETLKPATKAAELSVVSTSVISEQSEQPMPGMLEPSMTKILDSFTAAPVPMSTAALKSPE

PVVTMSVEYQKSVLKSLETMPPETSKTTLVELPIAKVVEPSETLTIVSETPTEVHPEPSPSTMDFPESSTTDVQRLPEQPVEAPSEIADSSMTRPQESLE

LPKTTAVELQESTVASALELPGPPATSILELQGPPVTPVPELPGPSATPVPELSGPLSTPVPELPGPPATVVPELPGPSVTPVPQLSQELPGPPAPSMGL

EPPQEVPEPPVMAQELSGVPAVSAAIELTGQPAVTVAMELTEQPVTTTEFEQPVAMTTVEHPGHPEVTTATGLLGQPEAAMVLELPGQPVATTALELSGQ

PSVTGVPELSGLPSATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSE

LSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDS

QMLASSTMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDS

QMLASGAMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMMGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPY

RVSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYE

RSMMSAYERSMMSPMADRSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPLPPEEPPTMPPLPPEE

PPMTPPLPPEEPPEGPALSTEQSALTADNTWSTEVTLSTGESLSQPEPPVSQSEISEPMAVPANYSMSESETSMLASEAVMTVPEPAREPESSVTSAPVE

SAVVAEHEMVPERPMTYMVSETTMSVEPAVLTSEASVISETSETYDSMRPSGHAISEVTMSLLEPAVTISQPAENSLELPSMTVPAPSTMTTTESPVVAV

TEIPPVAVPEPPIMAVPELPTMAVVKTPAVAVPEPLVAAPEPPTMATPELCSLSVSEPPVAVSELPALADPEHAITAVSGVSSLEPSVPILEPAVSVLQP

VMIVSEPSVPVQEPTVAVSEPAVIVSEHTQITSPEMAVESSPVIVDSSVMSSQIMKGMNLLGGDENLGPEVGMQETLLHPGEEPRDGGHLKSDLYENEYD

RNADLTVNSHLIVKDAEHNTVCATTVGPVGEASEEKILPISETKEITELATCAAVSEADIGRSLSSQLALELDTVGTSKGFEFVTASALISESKYDVEVS

VTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSTNFVCKDVEDSLPIKESAQAVAVALSPKESSEDTEVPLPNKEIVPESGYSASIDEINEADL

VRPLLPKDMERLTSLRAGIEGPLLASEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSE

HKSRKRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKAARARSRTPSRRSRSHT

PSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRRRSRSAVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS

SERGRSPKRLTDLD - UNI12617 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE F
Transcript ENSMUST00000119368
Sequence
GGAGTAGTTGAGAGAACGGAGCGGACGCCATGGCGGCCGACATCGAGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCT

TTCCAG - UNI4569 - - UNI17198 - TGGAAGGAGTGAAGGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACA

CAGCTGCCTCTGCAAGGAGTCTCCCAAATGAAGAAATAGTGCAGAAGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG 

- UNI25237 - ACTTGAAAGAGGCCTCCAGAAAAAGTAGATGCGTATCTGTGCAAACAGATCCTACTGATGAAGTGCCCACCAAAAAGTCAAAGAAGC

ATAAAAAGCACAAAAACAAAAAGAAGAAAAAGAAGAAAGAAAAAGAAAAAAAATATAAAAGACAACCAGAAGAATCTGAGTCCAAGCTGAAATCTCATCA

TGATGGGAATCTAGAATCTGATTCCTTCTTAAAGTTTGATTCTGAACCTTCAGCAGCGGCACTGGAACATCCTGTAAGAGCGTTTGGCTTATCTGAGGCC

AGTGAGACCGCCTTAGTGCTGGAACCTCCAGTAGTCTCAATGGAGGTTCAGGAGTCACACGTTCTAGAGACTCTGAAGCCAGCTACAAAAGCTGCAGAAC

TGTCAGTTGTGTCTACATCAGTAATCTCAGAGCAGTCTGAGCAGCCTATGCCAGGTATGCTGGAACCATCAATGACAAAGATCCTGGATTCCTTCACAGC

AGCACCAGTGCCTATGTCAACAGCGGCGCTGAAGTCACCTGAGCCCGTTGTAACAATGTCAGTGGAATATCAGAAGTCTGTGCTGAAATCTTTGGAGACT

ATGCCTCCAGAGACGTCAAAGACCACGCTGGTAGAGCTTCCCATAGCAAAAGTGGTTGAGCCATCAGAAACCCTCACGATAGTGTCAGAGACACCTACTG

AGGTGCACCCTGAACCAAGCCCATCAACAATGGATTTTCCAGAGTCATCTACAACTGACGTGCAAAGATTGCCAGAGCAGCCTGTAGAAGCACCATCGGA

GATTGCAGATTCATCCATGACAAGACCTCAGGAGTCACTGGAGCTGCCTAAGACCACAGCGGTGGAGCTGCAGGAGTCGACGGTGGCCTCAGCTCTGGAG

TTGCCGGGGCCACCTGCGACCTCCATTCTGGAGTTGCAGGGGCCCCCTGTGACTCCAGTGCCAGAGTTGCCTGGGCCCTCTGCCACCCCAGTGCCAGAGT

TGTCAGGGCCCCTTTCTACCCCAGTGCCTGAGTTGCCAGGGCCCCCTGCGACAGTGGTCCCTGAGTTGCCGGGGCCCTCTGTGACACCAGTGCCACAGTT

GTCGCAGGAATTGCCAGGGCCTCCAGCACCATCCATGGGGTTGGAGCCACCACAGGAGGTACCAGAGCCACCTGTGATGGCACAGGAGTTATCAGGGGTG

CCTGCAGTGTCGGCAGCGATAGAGTTGACAGGGCAACCTGCAGTAACAGTAGCAATGGAGTTGACCGAACAACCTGTGACGACGACAGAGTTCGAGCAGC

CTGTGGCGATGACAACGGTGGAGCATCCTGGGCATCCTGAGGTGACAACAGCTACAGGGTTGCTGGGGCAGCCAGAGGCAGCAATGGTGCTGGAGTTGCC

AGGCCAGCCAGTGGCAACCACAGCGCTGGAGTTGTCTGGGCAGCCTTCGGTGACTGGGGTGCCAGAGTTGTCAGGGCTGCCTTCGGCAACTAGGGCACTG

GAGTTGTCAGGGCAGTCTGTGGCAACTGGGGCATTAGAGTTGCCTGGTCAGCTCATGGCAACTGGGGCACTGGAGTTTTCGGGGCAGTCTGGGGCAGCTG

GAGCACTGGAGCTTTTGGGGCAGCCCCTAGCAACGGGGGTGCTAGAGTTACCAGGGCAGCCTGGAGCGCCAGAGTTGCCTGGGCAGCCTGTGGCAACTGT

GGCGCTGGAGATCTCTGTTCAGTCTGTGGTGACAACATCGGAGCTGTCAACGATGACCGTGTCGCAGTCCCTGGAGGTGCCCTCGACGACAGCGCTGGAA

TCCTATAATACGGTAGCACAGGAGCTGCCTACTACATTGGTGGGGGAGACTTCTGTAACAGTAGGAGTGGACCCCTTGATGGCCCAAGAATCCCATATGC

TAGCTTCTAACACCATGGAGACCCATATGTTAGCATCCAATACCATGGACTCCCAGATGCTAGCATCCAACACTATGGATTCTCAGATGCTAGCATCCAA

TACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCAACTAGCACCATGGAC

TCCCAGATGTTAGCAACTAGCTCTATGGACTCCCAGATGTTAGCAACTAGCTCTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGT

TAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCTCCATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAG

CAGTATGGACTCCCAGATGTTAGCAACCAGTTCCATGGACTCCCAGATGTTAGCATCTGGTGCTATGGATTCTCAGATGTTAGCTTCTGGCACTATGGAT

GCTCAGATGTTAGCATCTGGTACTATGGATGCCCAAATGTTAGCATCTAGTACCCAGGATTCTGCTATGATGGGTTCAAAGTCTCCTGATCCCTATAGGT

TAGCTCAGGATCCTTACAGATTAGCTCAGGATCCCTATAGGTTGGGTCATGACCCCTACAGGTTAGGCCATGATGCTTACAGGTTAGGACAAGACCCTTA

TAGATTAGGCCATGATCCCTACAGACTAACTCCGGATCCCTATAGGGTATCACCTAGGCCCTATAGAATAGCACCCAGGTCCTATAGGATAGCACCTAGG

CCATACAGGTTAGCACCTAGACCCTTGATGTTAGCATCTAGACGTTCTATGATGATGTCCTATGCTGCAGAACGTTCCATGATGTCATCTTATGAGCGCT

CTATGATGTCTTATGAACGCTCTATGATGTCCCCTATGGCTGAACGCTCTATGATGTCGGCCTATGAGCGCTCCATGATGTCAGCTTATGAGCGCTCCAT

GATGTCTCCTATGGCTGAGCGTTCTATGATGTCAGCTTATGAGCGCTCTATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGATCGATCC

ATGATGTCCATGGGTGCCGACCGGTCTATGATGTCATCGTACTCTGCAGCTGACCGGTCTATGATGTCATCGTACTCTGCAGCTGATCGATCAATGATGT

CATCTTACACTGATCGATCAATGATGTCTATGGCAGCTGATTCTTACACTGATTCTTATACTGATTCCTATACGGAGGCATATATGGTGCCACCTTTGCC

TCCTGAAGAGCCCCCAACAATGCCACCATTGCCACCCGAGGAACCACCAATGACACCCCCATTACCTCCTGAGGAACCACCAGAGGGTCCAGCATTATCA

ACAGAGCAGTCAGCATTAACAGCTGACAATACTTGGTCTACAGAGGTGACATTATCTACTGGAGAATCTCTATCACAGCCTGAGCCTCCTGTGAGTCAAA

GTGAGATTTCAGAGCCTATGGCAGTACCTGCTAATTATTCAATGTCAGAATCAGAAACTTCAATGTTAGCATCAGAGGCTGTTATGACTGTTCCAGAACC

TGCACGAGAGCCCGAGTCTTCAGTTACATCAGCACCAGTTGAGTCTGCTGTAGTAGCAGAACATGAAATGGTTCCAGAGAGACCGATGACTTACATGGTT

TCTGAGACTACCATGTCAGTCGAGCCAGCTGTGTTAACATCAGAGGCTTCTGTTATATCAGAGACATCAGAAACATATGATTCCATGAGACCTTCAGGAC

ATGCTATCTCAGAGGTAACTATGTCACTCTTGGAGCCAGCAGTAACTATTTCACAGCCAGCAGAGAACAGTCTAGAGCTCCCATCCATGACTGTCCCAGC

ACCTTCTACTATGACTACCACAGAATCTCCAGTTGTTGCTGTCACAGAAATTCCTCCTGTGGCTGTCCCAGAACCTCCCATTATGGCTGTTCCAGAACTC

CCCACCATGGCTGTAGTAAAAACCCCCGCTGTGGCTGTCCCAGAACCTCTTGTGGCTGCTCCAGAGCCTCCTACCATGGCTACTCCAGAACTTTGCTCCT

TATCTGTCTCAGAACCTCCTGTGGCTGTCTCGGAGCTTCCAGCTTTGGCTGACCCAGAGCATGCTATCACTGCAGTGTCAGGTGTTTCTTCCCTGGAGCC

TTCTGTGCCTATTTTGGAACCAGCAGTATCAGTCCTTCAACCTGTTATGATTGTTTCAGAACCGTCTGTTCCTGTCCAGGAACCTACCGTGGCAGTGTCA

GAACCTGCTGTCATAGTCTCAGAGCACACGCAAATAACATCACCTGAGATGGCTGTAGAGTCTTCACCAGTAATAGTGGACTCTAGTGTTATGTCATCAC

AGATTATGAAAGGAATGAATTTGCTTGGTGGTGATGAAAATCTTGGTCCAGAGGTTGGCATGCAGGAGACTCTGTTGCATCCAGGTGAAGAGCCACGTGA

TGGAGGACACTTGAAAAGTGACTTGTATGAAAATGAGTATGATAGAAATGCAGACCTTACTGTAAACAGTCATTTAATTGTTAAAGATGCAGAGCATAAC

ACAGTGTGTGCTACTACCGTTGGTCCTGTTGGTGAAGCAAGTGAAGAGAAAATTTTGCCTATTAGTGAGACTAAGGAAATCACAGAATTGGCTACCTGTG

CTGCCGTCAGCGAAGCTGACATAGGCAGAAGTCTGTCTTCTCAGCTTGCTCTGGAGCTGGATACAGTAGGAACTAGTAAGGGGTTTGAATTTGTCACTGC

ATCTGCACTCATTTCAGAGAGTAAATATGATGTTGAAGTATCTGTAACTACTCAAGATACTGAACATGACATGGTAATTTCCACCAGCCCCAGTGGTGGC

AGCGAAGCAGACATAGAGGGACCTTTGCCTGCTAAAGACATTCATCTTGATTTGCCATCAACTAATTTTGTTTGTAAGGATGTAGAAGACTCGTTACCTA

TCAAAGAGAGTGCCCAGGCAGTGGCAGTGGCTCTTAGCCCTAAAGAGAGCAGTGAAGATACAGAAGTACCTCTTCCCAATAAAGAAATAGTTCCTGAGTC

AGGATATTCTGCCAGCATTGATGAAATTAATGAAGCTGACTTAGTGAGACCATTACTTCCTAAGGACATGGAGCGTCTTACAAGCCTTAGAGCTGGCATT

GAAGGACCTTTACTTGCTAGTGAGGTTGAACGTGACAAGTCAGCTGCCAGTCCAGTTGTAATTAGCATACCAGAAAGAGCTTCAGAGTCATCTTCAGAGG

AAAAGGATGATTATGAAATTTTTGTCAAAGTTAAGGACACACATGAAAAAAGCAAGAAAAACAAAAACCGTGACAAAGGTGAGAAGGAGAAGAAAAGGGA

CTCTTCATTACGGTCTCGGAGTAAGCGTTCCAAGTCTTCTGAACATAAGTCACGCAAGCGCACCAGTGAGTCGCGTTCTAGAGCAAGGAAGAGGTCGTCC

AAGTCCAAATCTCACCGTTCTCAGACACGGTCACGGTCACGCTCAAGACGCAGGAGGAGGAGTAGCCGATCAAGATCTAAGTCTAGAGGAAGACGGTCTG

TATCAAAAGAGAAACGCAAAAGGTCTCCAAAGCATAGATCCAAGTCCAGGGAAAGGAAAAGGAAAAGATCAAGCTCACGAGACAACCGGAAAGCAGCTCG

AGCTCGGAGTCGAACCCCGAGTCGGCGGAGTAGGAGCCACACTCCTAGTCGGAGGAGACGGTCTAGATCTGTTGGTAGAAGGAGAAGTTTTAGCATTTCC

CCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCAGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCC

GAACCCCCAGCCGTCGGAGAAGATCACGGTCTGCGGTAAGAAGACGAAGCTTCAGTATATCACCGGTCAGATTAAGGCGATCAAGAACACCTTTGAGAAG

AAGGTTTAGTAGATCTCCCATTCGGCGGAAAAGATCCAGGTCTTCAGAAAGAGGCAGATCGCCCAAACGTCTAACAGATTTGG - UNI12617 - ATA

AGGCTCAATTACTTGAAATAGCCAAAGCTAATGCAGCTGCCATGTGTGCTAAGGCTGGTGTTCCTTTACCACCAAACCTAAAGCCTGCACCTCCACCTAC

AATAGAAGAGAAAGTTGCTAAAAAGTCTGGAGGAGCTACCATAGAAGAACTAACTGAG AAATGCAAACAGATTGCACAGAGTAAAGAAGATGATGATGT

AATAGTGAATAAACCTCATGTTTCGGATGAAGAGGAAGAAGAACCTCCTTTTTATCATCATCCCTTTAAACTCAGTGAACCCAAGCCCATTTTTTTCAAT

TTGAAT - UNI4682 - ATTGCTGCAGCAAAGCCAACTCCACCGAAAAGCCAAGTAACATTAACAAAGGAGTTTCCTGTGTCATCCGGATCTCAACAT

CGGAAAAAGGAAGCGGATAGTGTTTATGGAGAGTGGGTTCCAGTCGAGAAAAATGGTGAAGAAAGCAAAGATGATGATAATGTTTTCAGCAGCAGCTTGC

CCTCAGAG GGCCGGGTTAAACGGCAGGGCCGGGTTAAACGACAGATGAAACAACCCGCAGCTTCTCATTTGACAGTAACTCGATGCAATTCACTTTGTG

GAACGAAACCACAAAGTGAAAAGCATCGAATTGCAGAGAAAAGTGTTATCACATCCCTACCCAACATTGGGCCCTCCATGCACTTGTGGGAAGGTAGCCC

AAGGTACAACTATTTAGCTTCCCGTTTTGCTTCAAGGCTCTATAGCTCTAGATTTTGGTGGTAGCAAGTTTATTGGGTGGACGGATTGAGGGGAGAGAAG

GCAGATCTCAGGTTCAACACAAGAACTGCATTGAAAAAGTTCTTTTAGGCTGATGTGAACATCTTGGGGTTCATAGCCCATTGCCCTCCCGTGATGGCAT

CTTACTATTTCTCTGGGTTCTCAGTACGTCCCCTTCCTGTGCTACCTTAGCCCTTTTGAATTCTTGTGTTTAACCTGTGTTCAGCCTTGCTTCTCCATTC

CCTTCTCCTTCCCCTCTTTGCTACTATTAAAAGTTGGAGGAGTGGAATTTACATATTGAAATTTCTCAAGGCAATAGTTGTATCTTGTCAAAATGACACA

GTAACAATGCCAAATGTCAAAACAACCCCATTAAAATGCCGCCTGATTAAGTACTGTGCTGCTAATAAATACAGTGCACATGAGAACAGCAAAACTGTAT

ATATATGTAAATATATATATATATATCTGTATCTTTGTATGTATCTCTGTATCTGTATCTTTGCTGTGTCTTTTAATAAACAGTTTACTTTTATTTAA
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI25237 - DLKEASRKSRCVSVQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNLESDSFLKFDS

EPSAAALEHPVRAFGLSEASETALVLEPPVVSMEVQESHVLETLKPATKAAELSVVSTSVISEQSEQPMPGMLEPSMTKILDSFTAAPVPMSTAALKSPE

PVVTMSVEYQKSVLKSLETMPPETSKTTLVELPIAKVVEPSETLTIVSETPTEVHPEPSPSTMDFPESSTTDVQRLPEQPVEAPSEIADSSMTRPQESLE

LPKTTAVELQESTVASALELPGPPATSILELQGPPVTPVPELPGPSATPVPELSGPLSTPVPELPGPPATVVPELPGPSVTPVPQLSQELPGPPAPSMGL

EPPQEVPEPPVMAQELSGVPAVSAAIELTGQPAVTVAMELTEQPVTTTEFEQPVAMTTVEHPGHPEVTTATGLLGQPEAAMVLELPGQPVATTALELSGQ

PSVTGVPELSGLPSATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSE

LSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDS

QMLASSTMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDS

QMLASGAMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMMGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPY

RVSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYE

RSMMSAYERSMMSPMADRSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPLPPEEPPTMPPLPPEE

PPMTPPLPPEEPPEGPALSTEQSALTADNTWSTEVTLSTGESLSQPEPPVSQSEISEPMAVPANYSMSESETSMLASEAVMTVPEPAREPESSVTSAPVE

SAVVAEHEMVPERPMTYMVSETTMSVEPAVLTSEASVISETSETYDSMRPSGHAISEVTMSLLEPAVTISQPAENSLELPSMTVPAPSTMTTTESPVVAV

TEIPPVAVPEPPIMAVPELPTMAVVKTPAVAVPEPLVAAPEPPTMATPELCSLSVSEPPVAVSELPALADPEHAITAVSGVSSLEPSVPILEPAVSVLQP

VMIVSEPSVPVQEPTVAVSEPAVIVSEHTQITSPEMAVESSPVIVDSSVMSSQIMKGMNLLGGDENLGPEVGMQETLLHPGEEPRDGGHLKSDLYENEYD

RNADLTVNSHLIVKDAEHNTVCATTVGPVGEASEEKILPISETKEITELATCAAVSEADIGRSLSSQLALELDTVGTSKGFEFVTASALISESKYDVEVS

VTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSTNFVCKDVEDSLPIKESAQAVAVALSPKESSEDTEVPLPNKEIVPESGYSASIDEINEADL

VRPLLPKDMERLTSLRAGIEGPLLASEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSE

HKSRKRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKAARARSRTPSRRSRSHT

PSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRRRSRSAVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS

SERGRSPKRLTDLD - UNI12617 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE KCKQIAQSKEDDDVIVN

KPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLN - UNI4682 - IAAAKPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEESKDDDNV

FSSSLPSE GRVKRQGRVKRQMKQPAASHLTVTRCNSLCGTKPQSEKHRIAEKSVITSLPNIGPSMHLWEGSPRYNYLASRFASRLYSSRFWW
Transcript ENSMUST00000122302
Sequence
GTTGAGAGAACGGAGCGGACGCCATGGCGGCCGACATCGAGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCTTTCCAG

 - UNI4569 - - UNI17198 - TGGAAGGAGTGAAGGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACACAGCTG

CCTCTGCAAGGAGTCTCCCAAATGAAGAAATAGTGCAGAAGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG - UNI1

2617 - - UNI25237 - ATAAGGCTCAATTACTTGAAATAGCCAAAGCTAATGCAGCTGCCATGTGTGCTAAGGCTGGTGTTCCTTTACCACCAAAC

CTAAAGCCTGCACCTCCACCTACAATAGAAGAGAAAGTTGCTAAAAAGTCTGGAGGAGCTACCATAGAAGAACTAACTGAG AAATGCAAACAGATTGCA

CAGAGTAAAGAAGATGATGATGTAATAGTGAATAAACCTCATGTTTCGGATGAAGAGGAAGAAGAACCTCCTTTTTATCATCATCCCTTTAAACTCAGTG

AACCCAAGCCCATTTTTTTCAATTTGAAT - UNI4682 - ATTGCTGCAGCAAAGCCAACTCCACCGAAAAGCCAAGTAACATTAACAAAGGAGTTTC

CTGTGTCATCCGGATCTCAACATCGGAAAAAGGAAGCGGATAGTGTTTATGGAGAGTGGGTTCCAGTCGAGAAAAATGGTGAAGAAAGCAAAGATGATGA

TAATGTTTTCAGCAGCAGCTTGCCCTCAGAG CCTGTGGACATTTCAACAGCAATGAGTGAACGGGCACTTGCTCAGAAGAGGCTCAGTGAGAATGCATT

TGACCTTGAAGCCATGAGTATGTTAAACCGAGCTCAAGAACGG ATTGACGCCTGGGCTCAGTTGAATTCTATCCCTGGGCAGTTCACAGGGAGCACAGG

AGTGCAGGTCCTGACACAGGAGCAGCTGGCTAATACTGGGGCCCAAGCCTGGATTAAAAAG - UNI4868 - GATCAGTTCTTAAGAGCAGCCCCAGT

GACTGGAGGAATGGGAGCTGTTTTGATGAGAAAAATGGGCTGGAGAGAAGGAGAAGGATTAGGAAAGAACAAAGAAGGAAATAAGGAACCCATCCTTGTT

GATTTTAAGACAGACCGAAAAG - UNI11796 - GTCTTGTTGCAGTAGGAGAGAGAGCACAAAAGCGTTCTGGGAACTTCTCTGCTGCAATGAAAGA

CTTATCAG GCAAACATCCTGTGTCTGCCTTGATGGAAATCTGTAATAAGAGAAGGTGGCAACCACCTGAATTTCTCTTGGTCCATGACAGTGGCCCTGA

CCATCGCAAACATTTCCTCTTTAGG GTATTGAGAAATGGAAGCCCTTACCAGCCCAATTGTATGTTTTTCTTGAATAGGTATTGATAAATGGAAGCGCT

TACCAGCCCAGCTTTGCCAGCCCTAATAAGAAGCATGCTAAAGCCACAGCAGCAACTGTGGTTCTTCAAGCAATGGGCCTTGTACCAAAGGACCTCATGG

CTAATGCCACTTGCTTCAGGAGTGCCTCACGTAGATAGATTGAGGTTTTATATTAATCATTCAGATAATTTTACTCTGCATCACAATGTATTTCCTCCTT

AATGTTGTAAATATTTCACAATTTAAGACATTGTGTAAAAAGCAATCTGTACAAACATCTCCAGGCTTTCGTTTTTGTACCATGGAAATTGTATTTAACC

ATACAGGGTTTTGGTATGTTTATATTGTTTACCTTAGTGATGTATTTGTTTAAGTGGCTAACATCCAAACAATTGTTTGAGGGCATCAGTAATATTCAGT

GTGGAATGTTAAATAACGCTTTTATACTGTATTTTGTACTATGATGTAACTTCCCTTCCTTACGGCTAGGCTGCTGTAACACTTGCCTGTAATCAGTGAA

GGGCTGTGCACCTTGTACTATTTCACAATGGGTTCTGCTGGACAGATACTGGGCCAGTGTTATTAAGGCAATGAAGCAAGATCTGTTCCACAGGGCTATG

CCACCATCTCCCCCTTTTTGTAGAGATTATGAAAAGAAAGTGATACATTGTGTCATGATCAGTACTAAGTCCTGCATTCCCATTAAAGCCACTTGACTTG

GGTCATAAGAAGGAAGTCAAAATGGAAGTCCAACTTCAGAGGCCAAGTACATATTAGTATGGCTTCAGTTGTGATATAGTTTTACTTTGATGTGCATTTT

GAATTTCAGCTACACCTAGATAGACGTAAATAAAAATGCTGTAACCGACTTATCTAATAAAAATTGGCACCCAGCCGCTATTTTGTTGACTGAGGAAGTT

TATGTTAATTTTTTAGGGTCTGATAGAATATTCATGTGTATTACAGTGGTATTCATATGCTATGTCTCTAAACTTTATTTTCAAAAGCTTAAGGCCCAAA

TACAAACTTCTCTGGAATAAATGTTGTGTCTTATTCTCTGGCTTTTA
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI12617 - - UNI25237 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE KCKQIAQSK

EDDDVIVNKPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLN - UNI4682 - IAAAKPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGE

ESKDDDNVFSSSLPSE PVDISTAMSERALAQKRLSENAFDLEAMSMLNRAQER IDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAWIKK - UNI

4868 - DQFLRAAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKG - UNI11796 - GLVAVGERAQKRSGNFSAAMKDLSG GKH

PVSALMEICNKRRWQPPEFLLVHDSGPDHRKHFLFR VLRNGSPYQPNCMFFLNRY
Transcript ENSMUST00000023683
Sequence
GAATTGGCCGCTGCGCCTCCTCCCGAGGCATGCTGGGAGCCTGGAGGACTAGCGAGGAGTAGTTGAGAGAACGGAGCGGACGCCATGGCGGCCGACATCG

AGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCTTTCCAG - UNI4569 - - UNI17198 - TGGAAGGAGTGAA

GGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACACAGCTGCCTCTGCAAGGAGTCTCCCAAATGAAGAAATAGTGCAGA

AGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG - UNI25237 - ACTTGAAAGAGGCCTCCAGAAAAAGTAGATGC

GTATCTGTGCAAACAGATCCTACTGATGAAGTGCCCACCAAAAAGTCAAAGAAGCATAAAAAGCACAAAAACAAAAAGAAGAAAAAGAAGAAAGAAAAAG

AAAAAAAATATAAAAGACAACCAGAAGAATCTGAGTCCAAGCTGAAATCTCATCATGATGGGAATCTAGAATCTGATTCCTTCTTAAAGTTTGATTCTGA

ACCTTCAGCAGCGGCACTGGAACATCCTGTAAGAGCGTTTGGCTTATCTGAGGCCAGTGAGACCGCCTTAGTGCTGGAACCTCCAGTAGTCTCAATGGAG

GTTCAGGAGTCACACGTTCTAGAGACTCTGAAGCCAGCTACAAAAGCTGCAGAACTGTCAGTTGTGTCTACATCAGTAATCTCAGAGCAGTCTGAGCAGC

CTATGCCAGGTATGCTGGAACCATCAATGACAAAGATCCTGGATTCCTTCACAGCAGCACCAGTGCCTATGTCAACAGCGGCGCTGAAGTCACCTGAGCC

CGTTGTAACAATGTCAGTGGAATATCAGAAGTCTGTGCTGAAATCTTTGGAGACTATGCCTCCAGAGACGTCAAAGACCACGCTGGTAGAGCTTCCCATA

GCAAAAGTGGTTGAGCCATCAGAAACCCTCACGATAGTGTCAGAGACACCTACTGAGGTGCACCCTGAACCAAGCCCATCAACAATGGATTTTCCAGAGT

CATCTACAACTGACGTGCAAAGATTGCCAGAGCAGCCTGTAGAAGCACCATCGGAGATTGCAGATTCATCCATGACAAGACCTCAGGAGTCACTGGAGCT

GCCTAAGACCACAGCGGTGGAGCTGCAGGAGTCGACGGTGGCCTCAGCTCTGGAGTTGCCGGGGCCACCTGCGACCTCCATTCTGGAGTTGCAGGGGCCC

CCTGTGACTCCAGTGCCAGAGTTGCCTGGGCCCTCTGCCACCCCAGTGCCAGAGTTGTCAGGGCCCCTTTCTACCCCAGTGCCTGAGTTGCCAGGGCCCC

CTGCGACAGTGGTCCCTGAGTTGCCGGGGCCCTCTGTGACACCAGTGCCACAGTTGTCGCAGGAATTGCCAGGGCCTCCAGCACCATCCATGGGGTTGGA

GCCACCACAGGAGGTACCAGAGCCACCTGTGATGGCACAGGAGTTATCAGGGGTGCCTGCAGTGTCGGCAGCGATAGAGTTGACAGGGCAACCTGCAGTA

ACAGTAGCAATGGAGTTGACCGAACAACCTGTGACGACGACAGAGTTCGAGCAGCCTGTGGCGATGACAACGGTGGAGCATCCTGGGCATCCTGAGGTGA

CAACAGCTACAGGGTTGCTGGGGCAGCCAGAGGCAGCAATGGTGCTGGAGTTGCCAGGCCAGCCAGTGGCAACCACAGCGCTGGAGTTGTCTGGGCAGCC

TTCGGTGACTGGGGTGCCAGAGTTGTCAGGGCTGCCTTCGGCAACTAGGGCACTGGAGTTGTCAGGGCAGTCTGTGGCAACTGGGGCATTAGAGTTGCCT

GGTCAGCTCATGGCAACTGGGGCACTGGAGTTTTCGGGGCAGTCTGGGGCAGCTGGAGCACTGGAGCTTTTGGGGCAGCCCCTAGCAACGGGGGTGCTAG

AGTTACCAGGGCAGCCTGGAGCGCCAGAGTTGCCTGGGCAGCCTGTGGCAACTGTGGCGCTGGAGATCTCTGTTCAGTCTGTGGTGACAACATCGGAGCT

GTCAACGATGACCGTGTCGCAGTCCCTGGAGGTGCCCTCGACGACAGCGCTGGAATCCTATAATACGGTAGCACAGGAGCTGCCTACTACATTGGTGGGG

GAGACTTCTGTAACAGTAGGAGTGGACCCCTTGATGGCCCAAGAATCCCATATGCTAGCTTCTAACACCATGGAGACCCATATGTTAGCATCCAATACCA

TGGACTCCCAGATGCTAGCATCCAACACTATGGATTCTCAGATGCTAGCATCCAATACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCA

GATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCAACTAGCACCATGGACTCCCAG - UNI12617 - - UNI25237 - ATGTTAGCAACC

AGCTCCATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGTTCCATGG

ACTCCCAGATGTTAGCATCTGGTGCTATGGATTCTCAGATGTTAGCTTCTGGCACTATGGATGCTCAGATGTTAGCATCTGGTACTATGGATGCCCAAAT

GTTAGCATCTAGTACCCAGGATTCTGCTATGATGGGTTCAAAGTCTCCTGATCCCTATAGGTTAGCTCAGGATCCTTACAGATTAGCTCAGGATCCCTAT

AGGTTGGGTCATGACCCCTACAGGTTAGGCCATGATGCTTACAGGTTAGGACAAGACCCTTATAGATTAGGCCATGATCCCTACAGACTAACTCCGGATC

CCTATAGGGTATCACCTAGGCCCTATAGAATAGCACCCAGGTCCTATAGGATAGCACCTAGGCCATACAGGTTAGCACCTAGACCCTTGATGTTAGCATC

TAGACGTTCTATGATGATGTCCTATGCTGCAGAACGTTCCATGATGTCATCTTATGAGCGCTCTATGATGTCTTATGAACGCTCTATGATGTCCCCTATG

GCTGAACGCTCTATGATGTCGGCCTATGAGCGCTCCATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGAGCGTTCTATGATGTCAGCTT

ATGAGCGCTCTATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGATCGATCCATGATGTCCATGGGTGCCGACCGGTCTATGATGTCATC

GTACTCTGCAGCTGACCGGTCTATGATGTCATCGTACTCTGCAGCTGATCGATCAATGATGTCATCTTACACTGATCGATCAATGATGTCTATGGCAGCT

GATTCTTACACTGATTCTTATACTGATTCCTATACGGAGGCATATATGGTGCCACCTTTGCCTCCTGAAGAGCCCCCAACAATGCCACCATTGCCACCCG

AGGAACCACCAATGACACCCCCATTACCTCCTGAGGAACCACCAGAGGGTCCAGCATTATCAACAGAGCAGTCAGCATTAACAGCTGACAATACTTGGTC

TACAGAGGTGACATTATCTACTGGAGAATCTCTATCACAGCCTGAGCCTCCTGTGAGTCAAAGTGAGATTTCAGAGCCTATGGCAGTACCTGCTAATTAT

TCAATGTCAGAATCAGAAACTTCAATGTTAGCATCAGAGGCTGTTATGACTGTTCCAGAACCTGCACGAGAGCCCGAGTCTTCAGTTACATCAGCACCAG

TTGAGTCTGCTGTAGTAGCAGAACATGAAATGGTTCCAGAGAGACCGATGACTTACATGGTTTCTGAGACTACCATGTCAGTCGAGCCAGCTGTGTTAAC

ATCAGAGGCTTCTGTTATATCAGAGACATCAGAAACATATGATTCCATGAGACCTTCAGGACATGCTATCTCAGAGGTAACTATGTCACTCTTGGAGCCA

GCAGTAACTATTTCACAGCCAGCAGAGAACAGTCTAGAGCTCCCATCCATGACTGTCCCAGCACCTTCTACTATGACTACCACAGAATCTCCAGTTGTTG

CTGTCACAGAAATTCCTCCTGTGGCTGTCCCAGAACCTCCCATTATGGCTGTTCCAGAACTCCCCACCATGGCTGTAGTAAAAACCCCCGCTGTGGCTGT

CCCAGAACCTCTTGTGGCTGCTCCAGAGCCTCCTACCATGGCTACTCCAGAACTTTGCTCCTTATCTGTCTCAGAACCTCCTGTGGCTGTCTCGGAGCTT

CCAGCTTTGGCTGACCCAGAGCATGCTATCACTGCAGTGTCAGGTGTTTCTTCCCTGGAGCCTTCTGTGCCTATTTTGGAACCAGCAGTATCAGTCCTTC

AACCTGTTATGATTGTTTCAGAACCGTCTGTTCCTGTCCAGGAACCTACCGTGGCAGTGTCAGAACCTGCTGTCATAGTCTCAGAGCACACGCAAATAAC

ATCACCTGAGATGGCTGTAGAGTCTTCACCAGTAATAGTGGACTCTAGTGTTATGTCATCACAGATTATGAAAGGAATGAATTTGCTTGGTGGTGATGAA

AATCTTGGTCCAGAGGTTGGCATGCAGGAGACTCTGTTGCATCCAGGTGAAGAGCCACGTGATGGAGGACACTTGAAAAGTGACTTGTATGAAAATGAGT

ATGATAGAAATGCAGACCTTACTGTAAACAGTCATTTAATTGTTAAAGATGCAGAGCATAACACAGTGTGTGCTACTACCGTTGGTCCTGTTGGTGAAGC

AAGTGAAGAGAAAATTTTGCCTATTAGTGAGACTAAGGAAATCACAGAATTGGCTACCTGTGCTGCCGTCAGCGAAGCTGACATAGGCAGAAGTCTGTCT

TCTCAGCTTGCTCTGGAGCTGGATACAGTAGGAACTAGTAAGGGGTTTGAATTTGTCACTGCATCTGCACTCATTTCAGAGAGTAAATATGATGTTGAAG

TATCTGTAACTACTCAAGATACTGAACATGACATGGTAATTTCCACCAGCCCCAGTGGTGGCAGCGAAGCAGACATAGAGGGACCTTTGCCTGCTAAAGA

CATTCATCTTGATTTGCCATCAACTAATTTTGTTTGTAAGGATGTAGAAGACTCGTTACCTATCAAAGAGAGTGCCCAGGCAGTGGCAGTGGCTCTTAGC

CCTAAAGAGAGCAGTGAAGATACAGAAGTACCTCTTCCCAATAAAGAAATAGTTCCTGAGTCAGGATATTCTGCCAGCATTGATGAAATTAATGAAGCTG

ACTTAGTGAGACCATTACTTCCTAAGGACATGGAGCGTCTTACAAGCCTTAGAGCTGGCATTGAAGGACCTTTACTTGCTAGTGAGGTTGAACGTGACAA

GTCAGCTGCCAGTCCAGTTGTAATTAGCATACCAGAAAGAGCTTCAGAGTCATCTTCAGAGGAAAAGGATGATTATGAAATTTTTGTCAAAGTTAAGGAC

ACACATGAAAAAAGCAAGAAAAACAAAAACCGTGACAAAGGTGAGAAGGAGAAGAAAAGGGACTCTTCATTACGGTCTCGGAGTAAGCGTTCCAAGTCTT

CTGAACATAAGTCACGCAAGCGCACCAGTGAGTCGCGTTCTAGAGCAAGGAAGAGGTCGTCCAAGTCCAAATCTCACCGTTCTCAGACACGGTCACGGTC

ACGCTCAAGACGCAGGAGGAGGAGTAGCCGATCAAGATCTAAGTCTAGAGGAAGACGGTCTGTATCAAAAGAGAAACGCAAAAGGTCTCCAAAGCATAGA

TCCAAGTCCAGGGAAAGGAAAAGGAAAAGATCAAGCTCACGAGACAACCGGAAAGCAGCTCGAGCTCGGAGTCGAACCCCGAGTCGGCGGAGTAGGAGCC

ACACTCCTAGTCGGAGGAGACGGTCTAGATCTGTTGGTAGAAGGAGAAGTTTTAGCATTTCCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCAG

AACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGTCGGAGAAGATCACGGTCTGCGGTA

AGAAGACGAAGCTTCAGTATATCACCGGTCAGATTAAGGCGATCAAGAACACCTTTGAGAAGAAGGTTTAGTAGATCTCCCATTCGGCGGAAAAGATCCA

GGTCTTCAGAAAGAGGCAGATCGCCCAAACGTCTAACAGATTTGG - UNI12617 - ATAAGGCTCAATTACTTGAAATAGCCAAAGCTAATGCAGCT

GCCATGTGTGCTAAGGCTGGTGTTCCTTTACCACCAAACCTAAAGCCTGCACCTCCACCTACAATAGAAGAGAAAGTTGCTAAAAAGTCTGGAGGAGCTA

CCATAGAAGAACTAACTGAG AAATGCAAACAGATTGCACAGAGTAAAGAAGATGATGATGTAATAGTGAATAAACCTCATGTTTCGGATGAAGAGGAAG

AAGAACCTCCTTTTTATCATCATCCCTTTAAACTCAGTGAACCCAAGCCCATTTTTTTCAATTTGAAT - UNI4682 - ATTGCTGCAGCAAAGCCAA

CTCCACCGAAAAGCCAAGTAACATTAACAAAGGAGTTTCCTGTGTCATCCGGATCTCAACATCGGAAAAAGGAAGCGGATAGTGTTTATGGAGAGTGGGT

TCCAGTCGAGAAAAATGGTGAAGAAAGCAAAGATGATGATAATGTTTTCAGCAGCAGCTTGCCCTCAGAG CCTGTGGACATTTCAACAGCAATGAGTGA

ACGGGCACTTGCTCAGAAGAGGCTCAGTGAGAATGCATTTGACCTTGAAGCCATGAGTATGTTAAACCGAGCTCAAGAACGG ATTGACGCCTGGGCTCA

GTTGAATTCTATCCCTGGGCAGTTCACAGGGAGCACAGGAGTGCAGGTCCTGACACAGGAGCAGCTGGCTAATACTGGGGCCCAAGCCTGGATTAAAAAG

 - UNI4868 - GATCAGTTCTTAAGAGCAGCCCCAGTGACTGGAGGAATGGGAGCTGTTTTGATGAGAAAAATGGGCTGGAGAGAAGGAGAAGGATTA

GGAAAGAACAAAGAAGGAAATAAGGAACCCATCCTTGTTGATTTTAAGACAGACCGAAAAG - UNI11796 - GTCTTGTTGCAGTAGGAGAGAGAGC

ACAAAAGCGTTCTGGGAACTTCTCTGCTGCAATGAAAGACTTATCAG GCAAACATCCTGTGTCTGCCTTGATGGAAATCTGTAATAAGAGAAGGTGGCA

ACCACCTGAATTTCTCTTGGTCCATGACAGTGGCCCTGACCATCGCAAACATTTCCTCTTTAGG GTATTGAGAAATGGAAGCCCTTACCAGCCCAATTG

TATGTTTTTCTTGAATAGGTATTGATAAATGGAAGCGCTTACCAGCCCAGCTTTGCCAGCCCTAATAAGAAGCATGCTAAAGCCACAGCAGCAACTGTGG

TTCTTCAAGCAATGGGCCTTGTACCAAAGGACCTCATGGCTAATGCCACTTGCTTCAGGAGTGCCTCACGTAGATAGATTGAGGTTTTATATTAATCATT

CAGATAATTTTACTCTGCATCACAATGTATTTCCTCCTTAATGTTGTAAATATTTCACAATTTAAGACATTGTGTAAAAAGCAATCTGTACAAACATCTC

CAGGCTTTCGTTTTTGTACCATGGAAATTGTATTTAACCATACAGGGTTTTGGTATGTTTATATTGTTTACCTTAGTGATGTATTTGTTTAAGTGGCTAA

CATCCAAACAATTGTTTGAGGGCATCAGTAATATTCAGTGTGGAATGTTAAATAACGCTTTTATACTGTATTTTGTACTATGATGTAACTTCCCTTCCTT

ACGGCTAGGCTGCTGTAACACTTGCCTGTAATCAGTGAAGGGCTGTGCACCTTGTACTATTTCACAATGGGTTCTGCTGGACAGATACTGGGCCAGTGTT

ATTAAGGCAATGAAGCAAGATCTGTTCCACAGGGCTATGCCACCATCTCCCCCTTTTTGTAGAGATTATGAAAAGAAAGTGATACATTGTGTCATGATCA

GTACTAAGTCCTGCATTCCCATTAAAGCCACTTGACTTGGGTCATAAGAAGGAAGTCAAAATGGAAGTCCAACTTCAGAGGCCAAGTACATATTAGTATG

GCTTCAGTTGTGATATAGTTTTACTTTGATGTGCATTTTGAATTTCAGCTACACCTAGATAGACGTAAATAAAAATGCTGTAACCGACTTATCTAATAAA

AATTGGCACCCAGCCGCTATTTTGTTGACTGAGGAAGTTTATGTTAATTTTTTAGGGTCTGATAGAATATTCATGTGTATTACAGTGGTATTCATATGCT

ATGTCTCTAAACTTTATTTTCAAAAGCTTAAGGCCCAAATACAAACTTCTCTGGAAT
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI25237 - DLKEASRKSRCVSVQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNLESDSFLKFDS

EPSAAALEHPVRAFGLSEASETALVLEPPVVSMEVQESHVLETLKPATKAAELSVVSTSVISEQSEQPMPGMLEPSMTKILDSFTAAPVPMSTAALKSPE

PVVTMSVEYQKSVLKSLETMPPETSKTTLVELPIAKVVEPSETLTIVSETPTEVHPEPSPSTMDFPESSTTDVQRLPEQPVEAPSEIADSSMTRPQESLE

LPKTTAVELQESTVASALELPGPPATSILELQGPPVTPVPELPGPSATPVPELSGPLSTPVPELPGPPATVVPELPGPSVTPVPQLSQELPGPPAPSMGL

EPPQEVPEPPVMAQELSGVPAVSAAIELTGQPAVTVAMELTEQPVTTTEFEQPVAMTTVEHPGHPEVTTATGLLGQPEAAMVLELPGQPVATTALELSGQ

PSVTGVPELSGLPSATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSE

LSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDS

QMLASSTMDSQMLATSTMDSQ - UNI12617 - - UNI25237 - MLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLASGAMDSQML

ASGTMDAQMLASGTMDAQMLASSTQDSAMMGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPYRVSPRPYRIAPRS

YRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYERSMMSAYERSMMS

PMADRSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPLPPEEPPTMPPLPPEEPPMTPPLPPEEPP

EGPALSTEQSALTADNTWSTEVTLSTGESLSQPEPPVSQSEISEPMAVPANYSMSESETSMLASEAVMTVPEPAREPESSVTSAPVESAVVAEHEMVPER

PMTYMVSETTMSVEPAVLTSEASVISETSETYDSMRPSGHAISEVTMSLLEPAVTISQPAENSLELPSMTVPAPSTMTTTESPVVAVTEIPPVAVPEPPI

MAVPELPTMAVVKTPAVAVPEPLVAAPEPPTMATPELCSLSVSEPPVAVSELPALADPEHAITAVSGVSSLEPSVPILEPAVSVLQPVMIVSEPSVPVQE

PTVAVSEPAVIVSEHTQITSPEMAVESSPVIVDSSVMSSQIMKGMNLLGGDENLGPEVGMQETLLHPGEEPRDGGHLKSDLYENEYDRNADLTVNSHLIV

KDAEHNTVCATTVGPVGEASEEKILPISETKEITELATCAAVSEADIGRSLSSQLALELDTVGTSKGFEFVTASALISESKYDVEVSVTTQDTEHDMVIS

TSPSGGSEADIEGPLPAKDIHLDLPSTNFVCKDVEDSLPIKESAQAVAVALSPKESSEDTEVPLPNKEIVPESGYSASIDEINEADLVRPLLPKDMERLT

SLRAGIEGPLLASEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSEHKSRKRTSESRSR

ARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKAARARSRTPSRRSRSHTPSRRRRSRSVGRR

RSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRRRSRSAVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRSSERGRSPKRLTDL

D - UNI12617 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE KCKQIAQSKEDDDVIVNKPHVSDEEEEEPP

FYHHPFKLSEPKPIFFNLN - UNI4682 - IAAAKPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEESKDDDNVFSSSLPSE PVDI

STAMSERALAQKRLSENAFDLEAMSMLNRAQER IDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAWIKK - UNI4868 - DQFLRAAPVTGGMG

AVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKG - UNI11796 - GLVAVGERAQKRSGNFSAAMKDLSG GKHPVSALMEICNKRRWQPPEFLL

VHDSGPDHRKHFLFR VLRNGSPYQPNCMFFLNRY
Transcript ENSMUST00000114037
Sequence
GAATTGGCCGCTGCGCCTCCTCCCGAGGCATGCTGGGAGCCTGGAGGACTAGCGAGGAGTAGTTGAGAGAACGGAGCGGACGCCATGGCGGCCGACATCG

AGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCTTTCCAG - UNI4569 - - UNI17198 - TGGAAGGAGTGAA

GGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACACAGCTGCCTCTGCAAGGAGTCTCCCAAATGAAGAAATAGTGCAGA

AGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG - UNI25237 - ACTTGAAAGAGGCCTCCAGAAAAAGTAGATGC

GTATCTGTGCAAACAGATCCTACTGATGAAGTGCCCACCAAAAAGTCAAAGAAGCATAAAAAGCACAAAAACAAAAAGAAGAAAAAGAAGAAAGAAAAAG

AAAAAAAATATAAAAGACAACCAGAAGAATCTGAGTCCAAGCTGAAATCTCATCATGATGGGAATCTAGAATCTGATTCCTTCTTAAAGTTTGATTCTGA

ACCTTCAGCAGCGGCACTGGAACATCCTGTAAGAGCGTTTGGCTTATCTGAGGCCAGTGAGACCGCCTTAGTGCTGGAACCTCCAGTAGTCTCAATGGAG

GTTCAGGAGTCACACGTTCTAGAGACTCTGAAGCCAGCTACAAAAGCTGCAGAACTGTCAGTTGTGTCTACATCAGTAATCTCAGAGCAGTCTGAGCAGC

CTATGCCAGGTATGCTGGAACCATCAATGACAAAGATCCTGGATTCCTTCACAGCAGCACCAGTGCCTATGTCAACAGCGGCGCTGAAGTCACCTGAGCC

CGTTGTAACAATGTCAGTGGAATATCAGAAGTCTGTGCTGAAATCTTTGGAGACTATGCCTCCAGAGACGTCAAAGACCACGCTGGTAGAGCTTCCCATA

GCAAAAGTGGTTGAGCCATCAGAAACCCTCACGATAGTGTCAGAGACACCTACTGAGGTGCACCCTGAACCAAGCCCATCAACAATGGATTTTCCAGAGT

CATCTACAACTGACGTGCAAAGATTGCCAGAGCAGCCTGTAGAAGCACCATCGGAGATTGCAGATTCATCCATGACAAGACCTCAGGAGTCACTGGAGCT

GCCTAAGACCACAGCGGTGGAGCTGCAGGAGTCGACGGTGGCCTCAGCTCTGGAGTTGCCGGGGCCACCTGCGACCTCCATTCTGGAGTTGCAGGGGCCC

CCTGTGACTCCAGTGCCAGAGTTGCCTGGGCCCTCTGCCACCCCAGTGCCAGAGTTGTCAGGGCCCCTTTCTACCCCAGTGCCTGAGTTGCCAGGGCCCC

CTGCGACAGTGGTCCCTGAGTTGCCGGGGCCCTCTGTGACACCAGTGCCACAGTTGTCGCAGGAATTGCCAGGGCCTCCAGCACCATCCATGGGGTTGGA

GCCACCACAGGAGGTACCAGAGCCACCTGTGATGGCACAGGAGTTATCAGGGGTGCCTGCAGTGTCGGCAGCGATAGAGTTGACAGGGCAACCTGCAGTA

ACAGTAGCAATGGAGTTGACCGAACAACCTGTGACGACGACAGAGTTCGAGCAGCCTGTGGCGATGACAACGGTGGAGCATCCTGGGCATCCTGAGGTGA

CAACAGCTACAGGGTTGCTGGGGCAGCCAGAGGCAGCAATGGTGCTGGAGTTGCCAGGCCAGCCAGTGGCAACCACAGCGCTGGAGTTGTCTGGGCAGCC

TTCGGTGACTGGGGTGCCAGAGTTGTCAGGGCTGCCTTCGGCAACTAGGGCACTGGAGTTGTCAGGGCAGTCTGTGGCAACTGGGGCATTAGAGTTGCCT

GGTCAGCTCATGGCAACTGGGGCACTGGAGTTTTCGGGGCAGTCTGGGGCAGCTGGAGCACTGGAGCTTTTGGGGCAGCCCCTAGCAACGGGGGTGCTAG

AGTTACCAGGGCAGCCTGGAGCGCCAGAGTTGCCTGGGCAGCCTGTGGCAACTGTGGCGCTGGAGATCTCTGTTCAGTCTGTGGTGACAACATCGGAGCT

GTCAACGATGACCGTGTCGCAGTCCCTGGAGGTGCCCTCGACGACAGCGCTGGAATCCTATAATACGGTAGCACAGGAGCTGCCTACTACATTGGTGGGG

GAGACTTCTGTAACAGTAGGAGTGGACCCCTTGATGGCCCAAGAATCCCATATGCTAGCTTCTAACACCATGGAGACCCATATGTTAGCATCCAATACCA

TGGACTCCCAGATGCTAGCATCCAACACTATGGATTCTCAGATGCTAGCATCCAATACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCA

GATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCAACTAGCACCATGGACTCCCAGATGTTAGCAACTAGCTCTATGGACTCCCAGATGTTAGCA

ACTAGCTCTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCTCCA

TGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGTTCCATGGACTCCCA

GATGTTAGCATCTGGTGCTATGGATTCTCAGATGTTAGCTTCTGGCACTATGGATGCTCAGATGTTAGCATCTGGTACTATGGATGCCCAAATGTTAGCA

TCTAGTACCCAGGATTCTGCTATGATGGGTTCAAAGTCTCCTGATCCCTATAGGTTAGCTCAGGATCCTTACAGATTAGCTCAGGATCCCTATAGGTTGG

GTCATGACCCCTACAGGTTAGGCCATGATGCTTACAGGTTAGGACAAGACCCTTATAGATTAGGCCATGATCCCTACAGACTAACTCCGGATCCCTATAG

GGTATCACCTAGGCCCTATAGAATAGCACCCAGGTCCTATAGGATAGCACCTAGGCCATACAGGTTAGCACCTAGACCCTTGATGTTAGCATCTAGACGT

TCTATGATGATGTCCTATGCTGCAGAACGTTCCATGATGTCATCTTATGAGCGCTCTATGATGTCTTATGAACGCTCTATGATGTCCCCTATGGCTGAAC

GCTCTATGATGTCGGCCTATGAGCGCTCCATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGAGCGTTCTATGATGTCAGCTTATGAGCG

CTCTATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGATCGATCCATGATGTCCATGGGTGCCGACCGGTCTATGATGTCATCGTACTCT

GCAGCTGACCGGTCTATGATGTCATCGTACTCTGCAGCTGATCGATCAATGATGTCATCTTACACTGATCGATCAATGATGTCTATGGCAGCTGATTCTT

ACACTGATTCTTATACTGATTCCTATACGGAGGCATATATGGTGCCACCTTTGCCTCCTGAAGAGCCCCCAACAATGCCACCATTGCCACCCGAGGAACC

ACCAATGACACCCCCATTACCTCCTGAGGAACCACCAGAGGGTCCAGCATTATCAACAGAGCAGTCAGCATTAACAGCTGACAATACTTGGTCTACAGAG

GTGACATTATCTACTGGAGAATCTCTATCACAGCCTGAGCCTCCTGTGAGTCAAAGTGAGATTTCAGAGCCTATGGCAGTACCTGCTAATTATTCAATGT

CAGAATCAGAAACTTCAATGTTAGCATCAGAGGCTGTTATGACTGTTCCAGAACCTGCACGAGAGCCCGAGTCTTCAGTTACATCAGCACCAGTTGAGTC

TGCTGTAGTAGCAGAACATGAAATGGTTCCAGAGAGACCGATGACTTACATGGTTTCTGAGACTACCATGTCAGTCGAGCCAGCTGTGTTAACATCAGAG

GCTTCTGTTATATCAGAGACATCAGAAACATATGATTCCATGAGACCTTCAGGACATGCTATCTCAGAGGTAACTATGTCACTCTTGGAGCCAGCAGTAA

CTATTTCACAGCCAGCAGAGAACAGTCTAGAGCTCCCATCCATGACTGTCCCAGCACCTTCTACTATGACTACCACAGAATCTCCAGTTGTTGCTGTCAC

AGAAATTCCTCCTGTGGCTGTCCCAGAACCTCCCATTATGGCTGTTCCAGAACTCCCCACCATGGCTGTAGTAAAAACCCCCGCTGTGGCTGTCCCAGAA

CCTCTTGTGGCTGCTCCAGAGCCTCCTACCATGGCTACTCCAGAACTTTGCTCCTTATCTGTCTCAGAACCTCCTGTGGCTGTCTCGGAGCTTCCAGCTT

TGGCTGACCCAGAGCATGCTATCACTGCAGTGTCAGGTGTTTCTTCCCTGGAGCCTTCTGTGCCTATTTTGGAACCAGCAGTATCAGTCCTTCAACCTGT

TATGATTGTTTCAGAACCGTCTGTTCCTGTCCAGGAACCTACCGTGGCAGTGTCAGAACCTGCTGTCATAGTCTCAGAGCACACGCAAATAACATCACCT

GAGATGGCTGTAGAGTCTTCACCAGTAATAGTGGACTCTAGTGTTATGTCATCACAGATTATGAAAGGAATGAATTTGCTTGGTGGTGATGAAAATCTTG

GTCCAGAGGTTGGCATGCAGGAGACTCTGTTGCATCCAGGTGAAGAGCCACGTGATGGAGGACACTTGAAAAGTGACTTGTATGAAAATGAGTATGATAG

AAATGCAGACCTTACTGTAAACAGTCATTTAATTGTTAAAGATGCAGAGCATAACACAGTGTGTGCTACTACCGTTGGTCCTGTTGGTGAAGCAAGTGAA

GAGAAAATTTTGCCTATTAGTGAGACTAAGGAAATCACAGAATTGGCTACCTGTGCTGCCGTCAGCGAAGCTGACATAGGCAGAAGTCTGTCTTCTCAGC

TTGCTCTGGAGCTGGATACAGTAGGAACTAGTAAGGGGTTTGAATTTGTCACTGCATCTGCACTCATTTCAGAGAGTAAATATGATGTTGAAGTATCTGT

AACTACTCAAGATACTGAACATGACATGGTAATTTCCACCAGCCCCAGTGGTGGCAGCGAAGCAGACATAGAGGGACCTTTGCCTGCTAAAGACATTCAT

CTTGATTTGCCATCAACTAATTTTGTTTGTAAGGATGTAGAAGACTCGTTACCTATCAAAGAGAGTGCCCAGGCAGTGGCAGTGGCTCTTAGCCCTAAAG

AGAGCAGTGAAGATACAGAAGTACCTCTTCCCAATAAAGAAATAGTTCCTGAGTCAGGATATTCTGCCAGCATTGATGAAATTAATGAAGCTGACTTAGT

GAGACCATTACTTCCTAAGGACATGGAGCGTCTTACAAGCCTTAGAGCTGGCATTGAAGGACCTTTACTTGCTAGTGAGGTTGAACGTGACAAGTCAGCT

GCCAGTCCAGTTGTAATTAGCATACCAGAAAGAGCTTCAGAGTCATCTTCAGAGGAAAAGGATGATTATGAAATTTTTGTCAAAGTTAAGGACACACATG

AAAAAAGCAAGAAAAACAAAAACCGTGACAAAGGTGAGAAGGAGAAGAAAAGGGACTCTTCATTACGGTCTCGGAGTAAGCGTTCCAAGTCTTCTGAACA

TAAGTCACGCAAGCGCACCAGTGAGTCGCGTTCTAGAGCAAGGAAGAGGTCGTCCAAGTCCAAATCTCACCGTTCTCAGACACGGTCACGGTCACGCTCA

AGACGCAGGAGGAGGAGTAGCCGATCAAGATCTAAGTCTAGAGGAAGACGGTCTGTATCAAAAGAGAAACGCAAAAGGTCTCCAAAGCATAGATCCAAGT

CCAGGGAAAGGAAAAGGAAAAGATCAAGCTCACGAGACAACCGGAAAGCAGCTCGAGCTCGGAGTCGAACCCCGAGTCGGCGGAGTAGGAGCCACACTCC

TAGTCGGAGGAGACGGTCTAGATCTGTTGGTAGAAGGAGAAGTTTTAGCATTTCCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCAGAACCCCC

AGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGTCGGAGAAGATCACGGTCTGCGGTAAGAAGAC

GAAGCTTCAGTATATCACCGGTCAGATTAAGGCGATCAAGAACACCTTTGAGAAGAAGGTTTAGTAGATCTCCCATTCGGCGGAAAAGATCCAGGTCTTC

AGAAAGAGGCAGATCGCCCAAACGTCTAACAGATTTGG - UNI12617 - ATAAGGCTCAATTACTTGAAATAGCCAAAGCTAATGCAGCTGCCATGT

GTGCTAAGGCTGGTGTTCCTTTACCACCAAACCTAAAGCCTGCACCTCCACCTACAATAGAAGAGAAAGTTGCTAAAAAGTCTGGAGGAGCTACCATAGA

AGAACTAACTGAG AAATGCAAACAGATTGCACAGAGTAAAGAAGATGATGATGTAATAGTGAATAAACCTCATGTTTCGGATGAAGAGGAAGAAGAACC

TCCTTTTTATCATCATCCCTTTAAACTCAGTGAACCCAAGCCCATTTTTTTCAATTTGAAT - UNI4682 - ATTGCTGCAGCAAAGCCAACTCCACC

GAAAAGCCAAGTAACATTAACAAAGGAGTTTCCTGTGTCATCCGGATCTCAACATCGGAAAAAGGAAGCGGATAGTGTTTATGGAGAGTGGGTTCCAGTC

GAGAAAAATGGTGAAGAAAGCAAAGATGATGATAATGTTTTCAGCAGCAGCTTGCCCTCAGAG CCTGTGGACATTTCAACAGCAATGAGTGAACGGGCA

CTTGCTCAGAAGAGGCTCAGTGAGAATGCATTTGACCTTGAAGCCATGAGTATGTTAAACCGAGCTCAAGAACGG ATTGACGCCTGGGCTCAGTTGAAT

TCTATCCCTGGGCAGTTCACAGGGAGCACAGGAGTGCAGGTCCTGACACAGGAGCAGCTGGCTAATACTGGGGCCCAAGCCTGGATTAAAAAG - UNI4

868 - GATCAGTTCTTAAGAGCAGCCCCAGTGACTGGAGGAATGGGAGCTGTTTTGATGAGAAAAATGGGCTGGAGAGAAGGAGAAGGATTAGGAAAGA

ACAAAGAAGGAAATAAGGAACCCATCCTTGTTGATTTTAAGACAGACCGAAAAG - UNI11796 - GTCTTGTTGCAGTAGGAGAGAGAGCACAAAAG

CGTTCTGGGAACTTCTCTGCTGCAATGAAAGACTTATCAG GCAAACATCCTGTGTCTGCCTTGATGGAAATCTGTAATAAGAGAAGGTGGCAACCACCT

GAATTTCTCTTGGTCCATGACAGTGGCCCTGACCATCGCAAACATTTCCTCTTTAGG GTATTGAGAAATGGAAGCCCTTACCAGCCCAATTGTATGTTT

TTCTTGAATAGGTATTGATAAATGGAAGCGCTTACCAGCCCAGCTTTGCCAGCCCTAATAAGAAGCATGCTAAAGCCACAGCAGCAACTGTGGTTCTTCA

AGCAATGGGCCTTGTACCAAAGGACCTCATGGCTAATGCCACTTGCTTCAGGAGTGCCTCACGTAGATAGATTGAGGTTTTATATTAATCATTCAGATAA

TTTTACTCTGCATCACAATGTATTTCCTCCTTAATGTTGTAAATATTTCACAATTTAAGACATTGTGTAAAAAGCAATCTGTACAAACATCTCCAGGCTT

TCGTTTTTGTACCATGGAAATTGTATTTAACCATACAGGGTTTTGGTATGTTTATATTGTTTACCTTAGTGATGTATTTGTTTAAGTGGCTAACATCCAA

ACAATTGTTTGAGGGCATCAGTAATATTCAGTGTGGAATGTTAAATAACGCTTTTATACTGTATTTTGTACTATGATGTAACTTCCCTTCCTTACGGCTA

GGCTGCTGTAACACTTGCCTGTAATCAGTGAAGGGCTGTGCACCTTGTACTATTTCACAATGGGTTCTGCTGGACAGATACTGGGCCAGTGTTATTAAGG

CAATGAAGCAAGATCTGTTCCACAGGGCTATGCCACCATCTCCCCCTTTTTGTAGAGATTATGAAAAGAAAGTGATACATTGTGTCATGATCAGTACTAA

GTCCTGCATTCCCATTAAAGCCACTTGACTTGGGTCATAAGAAGGAAGTCAAAATGGAAGTCCAACTTCAGAGGCCAAGTACATATTAGTATGGCTTCAG

TTGTGATATAGTTTTACTTTGATGTGCATTTTGAATTTCAGCTACACCTAGATAGACGTAAATAAAAATGCTGTAACCGACTTATCTAATAAAAATTGGC

ACCCAGCCGCTATTTTGTTGACTGAGGAAGTTTATGTTAATTTTTTAGGGTCTGATAGAATATTCATGTGTATTACAGTGGTATTCATATGCTATGTCTC

TAAACTTTATTTTCAAAAGCTTAAGGCCCAAATACAAACTTCTCTGGAAT
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI25237 - DLKEASRKSRCVSVQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNLESDSFLKFDS

EPSAAALEHPVRAFGLSEASETALVLEPPVVSMEVQESHVLETLKPATKAAELSVVSTSVISEQSEQPMPGMLEPSMTKILDSFTAAPVPMSTAALKSPE

PVVTMSVEYQKSVLKSLETMPPETSKTTLVELPIAKVVEPSETLTIVSETPTEVHPEPSPSTMDFPESSTTDVQRLPEQPVEAPSEIADSSMTRPQESLE

LPKTTAVELQESTVASALELPGPPATSILELQGPPVTPVPELPGPSATPVPELSGPLSTPVPELPGPPATVVPELPGPSVTPVPQLSQELPGPPAPSMGL

EPPQEVPEPPVMAQELSGVPAVSAAIELTGQPAVTVAMELTEQPVTTTEFEQPVAMTTVEHPGHPEVTTATGLLGQPEAAMVLELPGQPVATTALELSGQ

PSVTGVPELSGLPSATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSE

LSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDS

QMLASSTMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDS

QMLASGAMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMMGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPY

RVSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYE

RSMMSAYERSMMSPMADRSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPLPPEEPPTMPPLPPEE

PPMTPPLPPEEPPEGPALSTEQSALTADNTWSTEVTLSTGESLSQPEPPVSQSEISEPMAVPANYSMSESETSMLASEAVMTVPEPAREPESSVTSAPVE

SAVVAEHEMVPERPMTYMVSETTMSVEPAVLTSEASVISETSETYDSMRPSGHAISEVTMSLLEPAVTISQPAENSLELPSMTVPAPSTMTTTESPVVAV

TEIPPVAVPEPPIMAVPELPTMAVVKTPAVAVPEPLVAAPEPPTMATPELCSLSVSEPPVAVSELPALADPEHAITAVSGVSSLEPSVPILEPAVSVLQP

VMIVSEPSVPVQEPTVAVSEPAVIVSEHTQITSPEMAVESSPVIVDSSVMSSQIMKGMNLLGGDENLGPEVGMQETLLHPGEEPRDGGHLKSDLYENEYD

RNADLTVNSHLIVKDAEHNTVCATTVGPVGEASEEKILPISETKEITELATCAAVSEADIGRSLSSQLALELDTVGTSKGFEFVTASALISESKYDVEVS

VTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSTNFVCKDVEDSLPIKESAQAVAVALSPKESSEDTEVPLPNKEIVPESGYSASIDEINEADL

VRPLLPKDMERLTSLRAGIEGPLLASEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSE

HKSRKRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKAARARSRTPSRRSRSHT

PSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRRRSRSAVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS

SERGRSPKRLTDLD - UNI12617 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE KCKQIAQSKEDDDVIVN

KPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLN - UNI4682 - IAAAKPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEESKDDDNV

FSSSLPSE PVDISTAMSERALAQKRLSENAFDLEAMSMLNRAQER IDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAWIKK - UNI4868 - D

QFLRAAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKG - UNI11796 - GLVAVGERAQKRSGNFSAAMKDLSG GKHPVSALMEI

CNKRRWQPPEFLLVHDSGPDHRKHFLFR VLRNGSPYQPNCMFFLNRY
Transcript ENSMUST00000117633
Sequence
CCCAGCTTTTTTTTTTTTCCATGGCCTCTAATCTCAGGCATTTACTCCCTATAGAAAGCCTCTTAGGAGTCCCCGCAGGCTGAGGGGATCAACAGCCGAA

GCTGTCGCGGTCGCCTCGGGAGCGACTTCTCCTGTAATGGCGCCTGCGTCAACCACTAACATGGCGGCCGAGTTCGTGCGCGGCGCAAACGTCAGCAGCT

CTACCCCGGCGGCTCAGAAACAGCGGAGGAGAGCGGGCCGGTGTTCGCTGATTGGCTCGTGGGTGGAGCGAGCCCGTGCGGACGCTCCCTCACGAGCCAA

TCAGGAAAGGGATAAAAGGAATTGGCCGCTGCGCCTCCTCCCGAGGCATGCTGGGAGCCTGGAGGACTAGCGAGGAGTAGTTGAGAGAACGGAGCGGACG

CCATGGCGGCCGACATCGAGCAGGTTTTCAGGTCTTTCGTGGTCAGTAAATTCCGGGAAATACAACAGGAGCTTTCCAG - UNI4569 - - UNI171

98 - TGGAAGGAGTGAAGGCCAGCTGAATGGTGAAACAAATCCACCCATTGAAGGGAACCAGGCAGGTGACACAGCTGCCTCTGCAAGGAGTCTCCCAA

ATGAAGAAATAGTGCAGAAGATAGAGGAGGTCCTCTCTGGGGTCTTAGATACGGAGCTGCGGTACAAGCCCG - UNI25237 - ACTTGAAAGAGGCC

TCCAGAAAAAGTAGATGCGTATCTGTGCAAACAGATCCTACTGATGAAGTGCCCACCAAAAAGTCAAAGAAGCATAAAAAGCACAAAAACAAAAAGAAGA

AAAAGAAGAAAGAAAAAGAAAAAAAATATAAAAGACAACCAGAAGAATCTGAGTCCAAGCTGAAATCTCATCATGATGGGAATCTAGAATCTGATTCCTT

CTTAAAGTTTGATTCTGAACCTTCAGCAGCGGCACTGGAACATCCTGTAAGAGCGTTTGGCTTATCTGAGGCCAGTGAGACCGCCTTAGTGCTGGAACCT

CCAGTAGTCTCAATGGAGGTTCAGGAGTCACACGTTCTAGAGACTCTGAAGCCAGCTACAAAAGCTGCAGAACTGTCAGTTGTGTCTACATCAGTAATCT

CAGAGCAGTCTGAGCAGCCTATGCCAGGTATGCTGGAACCATCAATGACAAAGATCCTGGATTCCTTCACAGCAGCACCAGTGCCTATGTCAACAGCGGC

GCTGAAGTCACCTGAGCCCGTTGTAACAATGTCAGTGGAATATCAGAAGTCTGTGCTGAAATCTTTGGAGACTATGCCTCCAGAGACGTCAAAGACCACG

CTGGTAGAGCTTCCCATAGCAAAAGTGGTTGAGCCATCAGAAACCCTCACGATAGTGTCAGAGACACCTACTGAGGTGCACCCTGAACCAAGCCCATCAA

CAATGGATTTTCCAGAGTCATCTACAACTGACGTGCAAAGATTGCCAGAGCAGCCTGTAGAAGCACCATCGGAGATTGCAGATTCATCCATGACAAGACC

TCAGGAGTCACTGGAGCTGCCTAAGACCACAGCGGTGGAGCTGCAGGAGTCGACGGTGGCCTCAGCTCTGGAGTTGCCGGGGCCACCTGCGACCTCCATT

CTGGAGTTGCAGGGGCCCCCTGTGACTCCAGTGCCAGAGTTGCCTGGGCCCTCTGCCACCCCAGTGCCAGAGTTGTCAGGGCCCCTTTCTACCCCAGTGC

CTGAGTTGCCAGGGCCCCCTGCGACAGTGGTCCCTGAGTTGCCGGGGCCCTCTGTGACACCAGTGCCACAGTTGTCGCAGGAATTGCCAGGGCCTCCAGC

ACCATCCATGGGGTTGGAGCCACCACAGGAGGTACCAGAGCCACCTGTGATGGCACAGGAGTTATCAGGGGTGCCTGCAGTGTCGGCAGCGATAGAGTTG

ACAGGGCAACCTGCAGTAACAGTAGCAATGGAGTTGACCGAACAACCTGTGACGACGACAGAGTTCGAGCAGCCTGTGGCGATGACAACGGTGGAGCATC

CTGGGCATCCTGAGGTGACAACAGCTACAGGGTTGCTGGGGCAGCCAGAGGCAGCAATGGTGCTGGAGTTGCCAGGCCAGCCAGTGGCAACCACAGCGCT

GGAGTTGTCTGGGCAGCCTTCGGTGACTGGGGTGCCAGAGTTGTCAGGGCTGCCTTCGGCAACTAGGGCACTGGAGTTGTCAGGGCAGTCTGTGGCAACT

GGGGCATTAGAGTTGCCTGGTCAGCTCATGGCAACTGGGGCACTGGAGTTTTCGGGGCAGTCTGGGGCAGCTGGAGCACTGGAGCTTTTGGGGCAGCCCC

TAGCAACGGGGGTGCTAGAGTTACCAGGGCAGCCTGGAGCGCCAGAGTTGCCTGGGCAGCCTGTGGCAACTGTGGCGCTGGAGATCTCTGTTCAGTCTGT

GGTGACAACATCGGAGCTGTCAACGATGACCGTGTCGCAGTCCCTGGAGGTGCCCTCGACGACAGCGCTGGAATCCTATAATACGGTAGCACAGGAGCTG

CCTACTACATTGGTGGGGGAGACTTCTGTAACAGTAGGAGTGGACCCCTTGATGGCCCAAGAATCCCATATGCTAGCTTCTAACACCATGGAGACCCATA

TGTTAGCATCCAATACCATGGACTCCCAGATGCTAGCATCCAACACTATGGATTCTCAGATGCTAGCATCCAATACCATGGACTCCCAGATGTTAGCCTC

TAGCACCATGGACTCCCAGATGTTAGCCTCTAGCACCATGGACTCCCAGATGTTAGCAACTAGCACCATGGACTCCCAGATGTTAGCAACTAGCTCTATG

GACTCCCAGATGTTAGCAACTAGCTCTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGA

TGTTAGCAACCAGCTCCATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAACCAGCAGTATGGACTCCCAGATGTTAGCAAC

CAGTTCCATGGACTCCCAGATGTTAGCATCTGGTGCTATGGATTCTCAGATGTTAGCTTCTGGCACTATGGATGCTCAGATGTTAGCATCTGGTACTATG

GATGCCCAAATGTTAGCATCTAGTACCCAGGATTCTGCTATGATGGGTTCAAAGTCTCCTGATCCCTATAGGTTAGCTCAGGATCCTTACAGATTAGCTC

AGGATCCCTATAGGTTGGGTCATGACCCCTACAGGTTAGGCCATGATGCTTACAGGTTAGGACAAGACCCTTATAGATTAGGCCATGATCCCTACAGACT

AACTCCGGATCCCTATAGGGTATCACCTAGGCCCTATAGAATAGCACCCAGGTCCTATAGGATAGCACCTAGGCCATACAGGTTAGCACCTAGACCCTTG

ATGTTAGCATCTAGACGTTCTATGATGATGTCCTATGCTGCAGAACGTTCCATGATGTCATCTTATGAGCGCTCTATGATGTCTTATGAACGCTCTATGA

TGTCCCCTATGGCTGAACGCTCTATGATGTCGGCCTATGAGCGCTCCATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGAGCGTTCTAT

GATGTCAGCTTATGAGCGCTCTATGATGTCAGCTTATGAGCGCTCCATGATGTCTCCTATGGCTGATCGATCCATGATGTCCATGGGTGCCGACCGGTCT

ATGATGTCATCGTACTCTGCAGCTGACCGGTCTATGATGTCATCGTACTCTGCAGCTGATCGATCAATGATGTCATCTTACACTGATCGATCAATGATGT

CTATGGCAGCTGATTCTTACACTGATTCTTATACTGATTCCTATACGGAGGCATATATGGTGCCACCTTTGCCTCCTGAAGAGCCCCCAACAATGCCACC

ATTGCCACCCGAGGAACCACCAATGACACCCCCATTACCTCCTGAGGAACCACCAGAGGGTCCAGCATTATCAACAGAGCAGTCAGCATTAACAGCTGAC

AATACTTGGTCTACAGAGGTGACATTATCTACTGGAGAATCTCTATCACAGCCTGAGCCTCCTGTGAGTCAAAGTGAGATTTCAGAGCCTATGGCAGTAC

CTGCTAATTATTCAATGTCAGAATCAGAAACTTCAATGTTAGCATCAGAGGCTGTTATGACTGTTCCAGAACCTGCACGAGAGCCCGAGTCTTCAGTTAC

ATCAGCACCAGTTGAGTCTGCTGTAGTAGCAGAACATGAAATGGTTCCAGAGAGACCGATGACTTACATGGTTTCTGAGACTACCATGTCAGTCGAGCCA

GCTGTGTTAACATCAGAGGCTTCTGTTATATCAGAGACATCAGAAACATATGATTCCATGAGACCTTCAGGACATGCTATCTCAGAGGTAACTATGTCAC

TCTTGGAGCCAGCAGTAACTATTTCACAGCCAGCAGAGAACAGTCTAGAGCTCCCATCCATGACTGTCCCAGCACCTTCTACTATGACTACCACAGAATC

TCCAGTTGTTGCTGTCACAGAAATTCCTCCTGTGGCTGTCCCAGAACCTCCCATTATGGCTGTTCCAGAACTCCCCACCATGGCTGTAGTAAAAACCCCC

GCTGTGGCTGTCCCAGAACCTCTTGTGGCTGCTCCAGAGCCTCCTACCATGGCTACTCCAGAACTTTGCTCCTTATCTGTCTCAGAACCTCCTGTGGCTG

TCTCGGAGCTTCCAGCTTTGGCTGACCCAGAGCATGCTATCACTGCAGTGTCAGGTGTTTCTTCCCTGGAGCCTTCTGTGCCTATTTTGGAACCAGCAGT

ATCAGTCCTTCAACCTGTTATGATTGTTTCAGAACCGTCTGTTCCTGTCCAGGAACCTACCGTGGCAGTGTCAGAACCTGCTGTCATAGTCTCAGAGCAC

ACGCAAATAACATCACCTGAGATGGCTGTAGAGTCTTCACCAGTAATAGTGGACTCTAGTGTTATGTCATCACAGATTATGAAAGGAATGAATTTGCTTG

GTGGTGATGAAAATCTTGGTCCAGAGGTTGGCATGCAGGAGACTCTGTTGCATCCAGGTGAAGAGCCACGTGATGGAGGACACTTGAAAAGTGACTTGTA

TGAAAATGAGTATGATAGAAATGCAGACCTTACTGTAAACAGTCATTTAATTGTTAAAGATGCAGAGCATAACACAGTGTGTGCTACTACCGTTGGTCCT

GTTGGTGAAGCAAGTGAAGAGAAAATTTTGCCTATTAGTGAGACTAAGGAAATCACAGAATTGGCTACCTGTGCTGCCGTCAGCGAAGCTGACATAGGCA

GAAGTCTGTCTTCTCAGCTTGCTCTGGAGCTGGATACAGTAGGAACTAGTAAGGGGTTTGAATTTGTCACTGCATCTGCACTCATTTCAGAGAGTAAATA

TGATGTTGAAGTATCTGTAACTACTCAAGATACTGAACATGACATGGTAATTTCCACCAGCCCCAGTGGTGGCAGCGAAGCAGACATAGAGGGACCTTTG

CCTGCTAAAGACATTCATCTTGATTTGCCATCAACTAATTTTGTTTGTAAGGATGTAGAAGACTCGTTACCTATCAAAGAGAGTGCCCAGGCAGTGGCAG

TGGCTCTTAGCCCTAAAGAGAGCAGTGAAGATACAGAAGTACCTCTTCCCAATAAAGAAATAGTTCCTGAGTCAGGATATTCTGCCAGCATTGATGAAAT

TAATGAAGCTGACTTAGTGAGACCATTACTTCCTAAGGACATGGAGCGTCTTACAAGCCTTAGAGCTGGCATTGAAGGACCTTTACTTGCTAGTGAGGTT

GAACGTGACAAGTCAGCTGCCAGTCCAGTTGTAATTAGCATACCAGAAAGAGCTTCAGAGTCATCTTCAGAGGAAAAGGATGATTATGAAATTTTTGTCA

AAGTTAAGGACACACATGAAAAAAGCAAGAAAAACAAAAACCGTGACAAAGGTGAGAAGGAGAAGAAAAGGGACTCTTCATTACGGTCTCGGAGTAAGCG

TTCCAAGTCTTCTGAACATAAGTCACGCAAGCGCACCAGTGAGTCGCGTTCTAGAGCAAGGAAGAGGTCGTCCAAGTCCAAATCTCACCGTTCTCAGACA

CGGTCACGGTCACGCTCAAGACGCAGGAGGAGGAGTAGCCGATCAAGATCTAAGTCTAGAGGAAGACGGTCTGTATCAAAAGAGAAACGCAAAAGGTCTC

CAAAGCATAGATCCAAGTCCAGGGAAAGGAAAAGGAAAAGATCAAGCTCACGAGACAACCGGAAAGCAGCTCGAGCTCGGAGTCGAACCCCGAGTCGGCG

GAGTAGGAGCCACACTCCTAGTCGGAGGAGACGGTCTAGATCTGTTGGTAGAAGGAGAAGTTTTAGCATTTCCCCCAGCCGCAGGAGCCGAACCCCCAGC

CGCAGGAGCAGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGCAGGAGCCGAACCCCCAGCCGTCGGAGAAGATCAC

GGTCTGCGGTAAGAAGACGAAGCTTCAGTATATCACCGGTCAGATTAAGGCGATCAAGAACACCTTTGAGAAGAAGGTTTAGTAGATCTCCCATTCGGCG

GAAAAGATCCAGGTCTTCAGAAAGAGGCAGATCGCCCAAACGTCTAACAGATTTGG - UNI12617 - ATAAGGCTCAATTACTTGAAATAGCCAAAG

CTAATGCAGCTGCCATGTGTGCTAAGGCTGGTGTTCCTTTACCACCAAACCTAAAGCCTGCACCTCCACCTACAATAGAAGAGAAAGTTGCTAAAAAGTC

TGGAGGAGCTACCATAGAAGAACTAACTGAG AAATGCAAACAGATTGCACAGAGTAAAGAAGATGATGATGTAATAGTGAATAAACCTCATGTTTCGGA

TGAAGAGGAAGAAGAACCTCCTTTTTATCATCATCCCTTTAAACTCAGTGAACCCAAGCCCATTTTTTTCAATTTGAAT - UNI4682 - ATTGCTGC

AGCAAAGCCAACTCCACCGAAAAGCCAAGTAACATTAACAAAGGAGTTTCCTGTGTCATCCGGATCTCAACATCGGAAAAAGGAAGCGGATAGTGTTTAT

GGAGAGTGGGTTCCAGTCGAGAAAAATGGTGAAGAAAGCAAAGATGATGATAATGTTTTCAGCAGCAGCTTGCCCTCAGAG CCTGTGGACATTTCAACA

GCAATGAGTGAACGGGCACTTGCTCAGAAGAGGCTCAGTGAGAATGCATTTGACCTTGAAGCCATGAGTATGTTAAACCGAGCTCAAGAACGG ATTGAC

GCCTGGGCTCAGTTGAATTCTATCCCTGGGCAGTTCACAGGGAGCACAGGAGTGCAGGTCCTGACACAGGAGCAGCTGGCTAATACTGGGGCCCAAGCCT

GGATTAAAAAG - UNI4868 - GATCAGTTCTTAAGAGCAGCCCCAGTGACTGGAGGAATGGGAGCTGTTTTGATGAGAAAAATGGGCTGGAGAGAAG

GAGAAGGATTAGGAAAGAACAAAGAAGGAAATAAGGAACCCATCCTTGTTGATTTTAAGACAGACCGAAAAG - UNI11796 - GTCTTGTTGCAGTA

GGAGAGAGAGCACAAAAGCGTTCTGGGAACTTCTCTGCTGCAATGAAAGACTTATCAG GCAAACATCCTGTGTCTGCCTTGATGGAAATCTGTAATAAG

AGAAGGTGGCAACCACCTGAATTTCTCTTGGTCCATGACAGTGGCCCTGACCATCGCAAACATTTCCTCTTTAGG GTATTGATAAATGGAAGCGCTTAC

CAGCCCAGCTTTGCCAGCCCTAATAAGAAGCATGCTAAAGCCACAGCAGCAACTGTGGTTCTTCAAGCAATGGGCCTTGTACCAAAGGACCTCATGGCTA

ATGCCACTTGCTTCAGGAGTGCCTCACGTAGATAGATTGAGGTTTTATATTAATCATTCAGATAATTTTACTCTGCATCACAATGTATTTCCTCCTTAAT

GTTGTAAATATTTCACAATTTAAGACATTGTGTAAAAAGCAATCTGTACAAACATCTCCAGGCTTTCGTTTTTGTACCATGGAAATTGTATTTAACCATA

CAGGGTTTTGGTATGTTTATATTGTTTACCTTAGTGATGTATTTGTTTAAGTGGCTAACATCCAAACAATTGTTTGAGGGCATCAGTAATATTCAGTGTG

GAATGTTAAATAACGCTTTTATACTGTATTTTGTACTATGATGTAACTTCCCTTCCTTACGGCTAGGCTGCTGTAACACTTGCCTGTAATCAGTGAAGGG

CTGTGCACCTTGTACTATTTCACAATGGGTTCTGCTGGACAGATACTGGGCCAGTGTTATTAAGGCAATGAAGCAAGATCTGTTCCACAGGGCTATGCCA

CCATCTCCCCCTTTTTGTAGAGATTATGAAAAGAAAGTGATACATTGTGTCATGATCAGTACTAAGTCCTGCATTCCCATTAAAGCCACTTGACTTGGGT

CATAAGAAGGAAGTCAAAATGGAAGTCCAACTTCAGAGGCCAAGTACATATTAGTATGGCTTCAGTTGTGATATAGTTTTACTTTGATGTGCATTTTGAA

TTTCAGCTACACCTAGATAGACGTAAATAAAAATGCTGTAACCGACTTATCTAATAAAAATTGGCACCCAGCCGCTATTTTGTTGACTGAGGAAGTTTAT

GTTAATTTTTTAGGGTCTGATAGAATATTCATGTGTATTACAGTGGTATTCATATGCTATGTCTCTAAACTTTATTTTCAAAAGCTTAAGGCCCAAATAC

AAACTTCTCTGGAATAAATGTTGTGTCTTA
Translation
MAADIEQVFRSFVVSKFREIQQELSS - UNI4569 - - UNI17198 - SGRSEGQLNGETNPPIEGNQAGDTAASARSLPNEEIVQKIEEVLSGVL

DTELRYKPD - UNI25237 - DLKEASRKSRCVSVQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNLESDSFLKFDS

EPSAAALEHPVRAFGLSEASETALVLEPPVVSMEVQESHVLETLKPATKAAELSVVSTSVISEQSEQPMPGMLEPSMTKILDSFTAAPVPMSTAALKSPE

PVVTMSVEYQKSVLKSLETMPPETSKTTLVELPIAKVVEPSETLTIVSETPTEVHPEPSPSTMDFPESSTTDVQRLPEQPVEAPSEIADSSMTRPQESLE

LPKTTAVELQESTVASALELPGPPATSILELQGPPVTPVPELPGPSATPVPELSGPLSTPVPELPGPPATVVPELPGPSVTPVPQLSQELPGPPAPSMGL

EPPQEVPEPPVMAQELSGVPAVSAAIELTGQPAVTVAMELTEQPVTTTEFEQPVAMTTVEHPGHPEVTTATGLLGQPEAAMVLELPGQPVATTALELSGQ

PSVTGVPELSGLPSATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSE

LSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDS

QMLASSTMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDS

QMLASGAMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMMGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPY

RVSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYE

RSMMSAYERSMMSPMADRSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPLPPEEPPTMPPLPPEE

PPMTPPLPPEEPPEGPALSTEQSALTADNTWSTEVTLSTGESLSQPEPPVSQSEISEPMAVPANYSMSESETSMLASEAVMTVPEPAREPESSVTSAPVE

SAVVAEHEMVPERPMTYMVSETTMSVEPAVLTSEASVISETSETYDSMRPSGHAISEVTMSLLEPAVTISQPAENSLELPSMTVPAPSTMTTTESPVVAV

TEIPPVAVPEPPIMAVPELPTMAVVKTPAVAVPEPLVAAPEPPTMATPELCSLSVSEPPVAVSELPALADPEHAITAVSGVSSLEPSVPILEPAVSVLQP

VMIVSEPSVPVQEPTVAVSEPAVIVSEHTQITSPEMAVESSPVIVDSSVMSSQIMKGMNLLGGDENLGPEVGMQETLLHPGEEPRDGGHLKSDLYENEYD

RNADLTVNSHLIVKDAEHNTVCATTVGPVGEASEEKILPISETKEITELATCAAVSEADIGRSLSSQLALELDTVGTSKGFEFVTASALISESKYDVEVS

VTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSTNFVCKDVEDSLPIKESAQAVAVALSPKESSEDTEVPLPNKEIVPESGYSASIDEINEADL

VRPLLPKDMERLTSLRAGIEGPLLASEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSE

HKSRKRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKAARARSRTPSRRSRSHT

PSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRRRSRSAVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS

SERGRSPKRLTDLD - UNI12617 - DKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTE KCKQIAQSKEDDDVIVN

KPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLN - UNI4682 - IAAAKPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEESKDDDNV

FSSSLPSE PVDISTAMSERALAQKRLSENAFDLEAMSMLNRAQER IDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAWIKK - UNI4868 - D

QFLRAAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKG - UNI11796 - GLVAVGERAQKRSGNFSAAMKDLSG GKHPVSALMEI

CNKRRWQPPEFLLVHDSGPDHRKHFLFR VLINGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR

For any suggestions or comments, please send an email to unitrap@crg.es