Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022996 (Wnt10b)
Chromosomal location
Chr 15: 98602193 - 98608581 (-)
Description
wingless related MMTV integration site 10b Gene [Source:MGI Symbol;Acc:MGI:108061]
Human Ortholog
not available
Omim not available
UniTrap UNI37619
Vector Insertion
Chr 15: 98604817 - 98605328
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088289
Sequence
GGGCTGCACATCGCCGTTCACGAGTGTCAGCACCAGCTGCGCGACCAGCGCTGGAACTGCT TGGGGGCCCCAGGTGTCCCTCACCTGAACAG - UNI3

7619 - AAAG - UNI37619 - ATTTTCTCCCCAGGTTTCCGTGAGAGTGCTTTCTCCTTCTCCATGCTGGCTGCTGGGGTCATGCATGCTGTTGCC

ACAGCCTGCAGCCTGGGCAAGCTGGTGAGCTGCGGCTGCGGATGGAAGG - UNI37619 - TCCCCAGCCCCGGCCCCCAGGACACGTGGGAATGGGG

TGGCTGTAACCACGACATGGACTTCGGAGAGAAGTTCTCTCGGGATTTCTTGGATTCCAGGGAGGCTCCCCGGGACATCCAGGCGAGAATGCGGATCCAC

AACAACAGGGTGGGACGCCAG GTGGTAACGGAAAACCTGAAGCGGAAGTGCAAATGCCATGGAACGTCAGGCAGCTGCCAATTCAAGACCTGTTGGAGG

GCAGCGCCAGAGTTCCGGGCCATCGGGGCAGCACTGAGGGAGCGGCTGAGCAGAGCCATCTTTATCGATACCCACAACCGCAACTCTGGAGCGTTCCAGC

CCCGCCTACGTCCGCGGCGCCTCTCTGGAGAGCTGGTTTACTTTGAGAAGTCTCCTGACTTCTGCGAGCGAGACCCTACTCTGGGCTCCCCAGGCACGAG

AGGCCGGGCTTGCAACAAGACCAGCCGCCTCTTGGATGGCTGTGGCAGCCTGTGCTGTGGCCGTGGGCACAACGTGCTCCGGCAGACGCGAGTGGAGCGC

TGCCACTGTCGTTTCCACTGGTGCTGTTATGTGCTGTGTGATGAGTGTAAAGTCACAGAGTGGGTCAATGTGTGTAAATGAAGGTGAGCCTCGCCTAGGC

ACGACGAGGAGGAGAAGCACTGTGTGAGGGCTGCTCTCTTTCAGCCCTTTGCTCGGATTTCTGTCTAGGGTTTATCGTGGCTCCCGGAAGCTCAGAGCAT

CTGCCTGAGAACAGCTCTGGGGGTGTAGGGTCAGGTGAAATCTGTAACGAGCAGCCTTTTGTGGGGGAAGTGGCCCCACACTCTGTTCTTAAACACTCGA

ATAGACTAAGATGAAATGCACTGTACTGTTAGCGTCTTCTCTACCTACAGCTCCCTCGGGCTCAGGTTCCTACTTCCTTTGGATAGGGAGTCTATCTTTT

GGCCACTCCTCTTCCTCGAAGGATAATAGCAGGCATTGTGTGGAGTCAATAAGACCCGTATATATAGCAAGAGACCACCTCTTCCTATTTGTGGTTCTCA

AACTCCTCCACTACAGCCCAGAACCTCCTCTTATGGGACCTCGGGTGACAATAATGAGAGGTTTTCGGTTGGAAAAGGACAGAGGGCAGGGAAGCCTCAG

ACAGCTGTCTTGTCAGGCTCTTGGGAGGCTTCTCCTTCCGTTCAGTTGTTGAAAGGGTCTCTCCAAAGGAAAGGTTTTAGCCATAACTCTTGGAGGCCCT

TTTCCTTCTTCAGCAGGAAGGGTGGGAATGGATAATTTATTTTACTGAGATGTGTTCTTGGTTCCTGTTTGAAACTAAAATAAATTAAGTTACTG
Translation
GLHIAVHECQHQLRDQRWNCL LGAPGVPHLNR - UNI37619 - RK - UNI37619 - IFSPGFRESAFSFSMLAAGVMHAVATACSLGKLVSCG

CGWKV - UNI37619 - VPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQ VVTENLKRKCKCHGTSGSCQFKTCWRA

APEFRAIGAALRERLSRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERC

HCRFHWCCYVLCDECKVTEWVNVCK
Transcript ENSMUST00000023732
Sequence
CTCGAGCAGAACCACCCGTGAGTTAGGTCGAGCAGAGCCAAAGCCCCCGGTGCTTCGTCGCGGGTTCGCTCGCTAGCTATCTGGATCACTCCCTCCCTTT

TACCCTCCCTTCCTCCCGGCGGGCGGCCGCGGCGACGCCGGGGAAGCGGCAGAGAGGAGTGGCTGGGCGCTGGGAGAATGCTGCTCCGCCGAGGGGGCTG

AACCCGACAGTTTCCCCACGGTTTAAGCCCCAAGAGCCGGGCCCGAGTGACTCAACCGCGAGCCTTGTGGATCCTGCACCTGAACCGCTGGAG GCTGAC

TGACTCGCCCACCGGAGCCTCCGGGCTTCGACATGCTGGAGGAGCCCCGGTCTCGGCCTCCGCCCTTAGGCCTCGCGGGTCTCCTGTTCTTGGCTTTGTT

CAGTCG GGCTCTAAGCAATGAGATTCTGGGCCTTAAACTTCCCGGTGAGCCGCCGCTGACGGCCAACACCGTGTGCTTGACCCTGTCCGGACTGAGTAA

GCGACAGCTGGGGCTGTGCCTGCGCAGCCCCGACGTGACGGCGTCGGCGCTCCAGGGGCTGCACATCGCCGTTCACGAGTGTCAGCACCAGCTGCGCGAC

CAGCGCTGGAACTGCTCGGCACTGGAGGGCGGCGGCCGGCTGCCGCACCACAGCGCCATCCTCAAGCGCG - UNI37619 - GTTTCCGTGAGAGTGC

TTTCTCCTTCTCCATGCTGGCTGCTGGGGTCATGCATGCTGTTGCCACAGCCTGCAGCCTGGGCAAGCTGGTGAGCTGCGGCTGCGGATGGAAGGGTAGT

GGTGAGCAAGACCGGCTTAGAGCCAAGCTGCTGCAGCTTCAGGCACTGTCTCGGGGCAAGACTTTCCCCATCTCCCAGCCCAGCCCTGTTCCTGGCTCAG

TCCCCAGCCCCGGCCCCCAGGACACGTGGGAATGGGGTGGCTGTAACCACGACATGGACTTCGGAGAGAAGTTCTCTCGGGATTTCTTGGATTCCAGGGA

GGCTCCCCGGGACATCCAGGCGAGAATGCGGATCCACAACAACAGGGTGGGACGCCAG GTGGTAACGGAAAACCTGAAGCGGAAGTGCAAATGCCATGG

AACGTCAGGCAGCTGCCAATTCAAGACCTGTTGGAGGGCAGCGCCAGAGTTCCGGGCCATCGGGGCAGCACTGAGGGAGCGGCTGAGCAGAGCCATCTTT

ATCGATACCCACAACCGCAACTCTGGAGCGTTCCAGCCCCGCCTACGTCCGCGGCGCCTCTCTGGAGAGCTGGTTTACTTTGAGAAGTCTCCTGACTTCT

GCGAGCGAGACCCTACTCTGGGCTCCCCAGGCACGAGAGGCCGGGCTTGCAACAAGACCAGCCGCCTCTTGGATGGCTGTGGCAGCCTGTGCTGTGGCCG

TGGGCACAACGTGCTCCGGCAGACGCGAGTGGAGCGCTGCCACTGTCGTTTCCACTGGTGCTGTTATGTGCTGTGTGATGAGTGTAAAGTCACAGAGTGG

GTCAATGTGTGTAAATGAAGGTGAGCCTCGCCTAGGCACGACGAGGAGGAGAAGCACTGTGTGAGGGCTGCTCTCTTTCAGCCCTTTGCTCGGATTTCTG

TCTAGGGTTTATCGTGGCTCCCGGAAGCTCAGAGCATCTGCCTGAGAACAGCTCTGGGGGTGTAGGGTCAGGTGAAATCTGTAACGAGCAGCCTTTTGTG

GGGGAAGTGGCCCCACACTCTGTTCTTAAACACTCGAATAGACTAAGATGAAATGCACTGTACTGTTAGCGTCTTCTCTACCTACAGCTCCCTCGGGCTC

AGGTTCCTACTTCCTTTGGATAGGGAGTCTATCTTTTGGCCACTCCTCTTCCTCGAAGGATAATAGCAGGCATTGTGTGGAGTCAATAAGACCCGTATAT

ATAGCAAGAGACCACCTCTTCCTATTTGTGGTTCTCAAACTCCTCCACTACAGCCCAGAACCTCCTCTTATGGGACCTCGGGTGACAATAATGAGAGGTT

TTCGGTTGGAAAAGGACAGAGGGCAGGGAAGCCTCAGACAGCTGTCTTGTCAGGCTCTTGGGAGGCTTCTCCTTCCGTTCAGTTGTTGAAAGGGTCTCTC

CAAAGGAAAGGTTTTAGCCATAACTCTTGGAGGCCCTTTTCCTTCTTCAGCAGGAAGGGTGGGAATGGATAATTTATTTTACTGAGATGTGTTCTTGGTT

CCTGTTTGAAACTAAAATAAATTAAGTTACTG
Translation
 MLEEPRSRPPPLGLAGLLFLALFSR RALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSAL

EGGGRLPHHSAILKRG - UNI37619 - GFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSPVP

GSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQ VVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSR

AIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDECKV

TEWVNVCK

For any suggestions or comments, please send an email to unitrap@crg.es