Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023009 (C230021P08Rik)
Chromosomal location
Chr 15: 99252466 - 99288179 (-)
Description
Riken cDNA C230021P08 gene Gene [Source:MGI Symbol;Acc:MGI:3609653]
RefSeq_dna
NM_001001884 
RefSeq_peptide
NP_001001884.1 
UniGene
Mm.22915 
MGI
MGI:3609653 
Uniprot/SWISSPROT
Q6GQX2 
Human Ortholog
ENSG00000167566 (KIAA1602)
Omim not available
UniTrap UNI4708
Vector Insertion
Chr 15: 99266519 - 99288062
Public Clones XT0483 (sanger)
Private Clones OST295690 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32971
Vector Insertion
Chr 15: 99255983 - 99259899
Public Clones IST12574A1 (tigm) IST12574B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35583
Vector Insertion
Chr 15: 99252465 - 99253710
Public Clones IST13668H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023747
Sequence
GACATCAAGAGGTGGCTCCGGTACCCCCCTTTTCCTGCACCCCCCTCGCCCTCCCGCCCCCGAGATGCGGCCATGGACCCTGTGGACCAAGCCAGTCGAG

CTCAGCACCTGATTTCG - UNI4708 - GTGAGGTGACCCATCTGGCTGCCAGAGTGAACGAGCCAGCCTGGTGAGGAACAGAGACCTG CCTGCCAG

GCCTCATTCCCAGAGCCTGACTCCCAAGGTCATGGACCAGCCGGCCGGAGGCACCGGAAAGCTGAGGGCATCGGCTGGTGAGGACGACAGCATGGAGCTC

AGCACCTGCCAGGAGCTTCTGCACCGACTTCGGGAGCTGGAG GCAGAGAACTCGGCGCTTGCGCAGGCCAATGAGAACCAGCGGGAGACTTACGAACGC

TGTCTGGATGAG GTTGCCAACCACGTGGTACAGGCTCTACTGAACCAGAAG GACCTGCGGGAAGAGTGTATCAAACTGAAGAAGAGGGTGTTTGACCT

GGAGCGGCAGAATCAGGTGTTGAGTGCACTACTGCAGCAGAAACTACAGCTCACGGCCAACTCCCTCCCTCAG - UNI32971 - ATCCCACTCACAC

CACTCCAGCCGCCATCAGAACGACCAACCTCCCCAGCCCCAAATGTCTCTGAGGGACCAGCCACCTCACTGCCTTCAGGACTCTGTGCTGGGCAAAGAGA

G - UNI32971 - GTGTGTTGGGAGCAGCAGTTACGGCCAGGCGGTCCAGGTCCCCCGGCTACTCCACCCCCGGCGCTGGATGCCCTGTCCCCATTTC

TTCGGAAGAAAGCTCAGATTTTAGAGGTGCTGCGAGCCTTGGAAGAGACGGACCCTTTGCTTTTGTGCTCACCTGCCACCCCCTGGAGACCCACAGGCCA

AGGCCCTGGCTCCCCAGAGCCCATCAATGGCGAGCCCTGTGGCCCACCGCAGCCTGAACCCTCACCCTGGGCACCCTACCTGCTGCTCGGTCCTGGGAGC

CTGGGGGCACTGCTGCACTGGGAGCGGGTCTTAGGGGGCCCTGGGGAAGAAGAAGGCATCCGGCAACCCTGGGCTTCTAGCAGGGCCCCACCGTCAGCCC

AGGGCCCCAGCTCCGGCCCACACTGTGCTCCAGGCAGCAGCTCCTCCTCTTCTTCTGATGAAGCAGGAGACCCCAATGAGGCCCCCAGCCCCGACACCCT

GCTTGGTGCCCTGGCCCGCAAACAGTTAAATCTAGGCCAGCTCCTTGGAGACACAGAGACTTACCTCCAAGCTTTCCTGGCTGGGGCGACAGGCCCCCTC

AGTGGCGACCAGCCAGGCCCTGGGAAGCCAAACTCACCAGATCCAGGACCCCCACAGGTGTCCAAGTCCAAAGGCCTCCCAAAGTCAGCTTGGGGTGCAA

GTACCCCAGAGGCCACCAGGCTGGGCTTTGGTGCTACCTCAGAGGGCCAGGGGCCCCTTCCCTTCCTCAGCATGTTCATGGGTGCAGGGGATGCCCCGCT

GGGGTCCCGGCCTGGCCATCCCCACTCCTCATCTCAGGTGAAAAGCAAGCTCCAGATTGGGCCCCCCTCCCCCGGGGACGCCCAGGGACCCCTTCTGCCC

TCTCCAGCCAGAGGTCTCAAGTTTCTCAAGCTGCCTCCAGCCTCAGAGAAGGTCCCCAGCCCAGGAGGTCCCCAACTCAGTCCCCAGCTTCCCCGGAGCT

CTCGAATCCCTTGTCGCAACAGTGGCTCAGATGGCAGCCCCTCCCCATTGCTGGCTCGAAGGGGTCTGGGTGGAGGAGAGCTGTCCCCAGAGGGGGCACA

GGGCCTGCCCGGCAGCCCTCTGCCCTGCTCCGCAATGCCAGACTCTGCGCAGCTCAGACCCTCCCAGTCGACTGTGTCCACTGCTCTGTCTCCAGGACCC

GTAGTGTCTCCCTGCTTTGAAAACATCCTAGACCTTTCCCGGAGCACCTTTAGGGGTTCTCCCCCAGAACCACCTCCTTCCCCGCTGCAGGTGCCCACCT

ACCCACAATTGACTCTGGAGGTGCCCCAGACCCCTGAGGTCCTCAGGAGCCCTGGGGCCCCCAGCCCTGGCCTTCCAGAATCTTGTCCCTACAGCGGCCC

CCAGGAGAAGAGCATGGACAGGGCAGGCTCTGAGTCTCCCCATGCCAGCCGCAGGACCCCGGGTGGCTCATCCAAGAAGCCTGGCCAGGGATCTGGGCGA

CGACCTGGTGATCCTAGCCACACACCTCTGCGAGACAGATTGGCAGCACTTGGGAAACTGAAGACAGGCCCCGAGGGGCCTCTGGGTCCAGAAAAGAATG

GGGTGCCAGCCCGGTCTAGCGCTGAGAAGGCCAGGGCACTAGTGCGGTCTGGTGAGTGTGCTGGAGACGTGCCGCCCAGCGCAAGACCTCTGGAGCAGCC

AGAAGCTAAGGGTATCTTTCGGGGAGCAGTGGCCTTGGGCACAAGCAGCCTGAAGCAGCAGGAACCGGGACTTACAGATCCTGGTGCCAGAGTCTACTCC

TCTCATTCCATGGGAGCTCGAGTGGACCTGGAGCCCATCTCACCGAGGAGCTGCCTCACCAAAGTGGAGCTGGCCAAGAGTCGGCTAGCAGGGGCTCTGT

GTCCCCAGATGCCCCGCACACCTGCAAAAGTGCCAACCTCAGCCCCTAGCCTGGGCAAACCCAAAAGCCCTCACAGCAGCCCGACAAAGCTACCCTCCAA

GTCCCCCACCAAGGTGGTACCCCGCCCTGTGGTACCCTTAGGCACCAAGGAGCCCCCCAAGCCTGACAAAGTGAAGGGCCCACCCTGGGCAGATTGTGGC

AGCACAGTTGGCCAGCCTACATCCCCAGTAGCCGGCCCCGCCGACCCAAGCCAGGGCTCAGAAGGGCCAGCCCCACACTCGGCCATCGAGGAGAAGGTGA

TGAAGGGCATTGAGGAGAACGTGCTGCGCCTTCAAGGTCAGGAACGGACTCCGGGCTCCGAAGCCAAACACCGCAACACCAGCAGCATCGCCAGCTGGTT

TGGCCTTAAAAAGAGCAAGCTGCCGGCTCTGAACCGCCGCACTGAGGCTACCAAAAACAAGGACGGGGCCGGTGGGGGCTCCCCACTCCGGAAAGAAGTC

AAGACGGAAGCCCGGAAGCTGGAGGCTGAGAGCCTCAACATCTCCAAGCTGATGGCGAAGGCAGAAGACCTGCGCCGAGCCCTAGAGGAAGAGAAGGCGT

ACCTGAGCAGAGCCCGCCCACGGCCTGGGGGCCCAGCCACCGTGCCCAGTCCTGGTCTGGGGCAGGCGCAAGGCCAGCTAGCCGGCATGTATCAGGGTGC

AGACACCTTCATGCAACAGCTACTGAACAG - UNI32971 - GGTGGATGGCAAGGAGCTGCCCCCCAAGAGCTGGCGGGAACCCAAGCCTGAGTATG

GGGATTTCCAGCCAGTGTCCACTGACCCCAAGAGCCCCTGGCCTGCCTGTGGGCCTCGGAATGGCCTGGTAGGCCCACTCCAGGGCTGCGGAAAACCTGG

GAAG CCCAGCAGTGAGCCAGGAAGGCGGGAAGAGATGCCCTCTGAAGACAGCCTGGCGGAGCCAGTTTCCACCACGCACTTCACAG CCTGCGGCTCCT

TGACTCGAACCTTGGACAGTGGCATTGGGACCTTCCCACCCCCAGATCACAGCAGCAGCGGAACCCCCAGCAAAAATCTCCCCAAGACCAAGTCACTGCG

CCTGGATCCCCCACCAGGGGCACCCCCAGCTCGGCCTCCAGGCCTCACCAAAGTCCCCCGCCGTGCCCACACACTAGAGCGAGAGGTGCCGGGCATAGAG

GAGCTGCTGGTGAGTGGGCGACACCCCAGCATGCCAGCCTTCCCTGGACTGCTCACAGCTCCCCCAGGCCACCGAAGCCATCAGACCTGTCCCGATG - 

UNI35583 - ATCCCTGTGAAGACCCAGGCCCTCCCCCACCTGTCCAGCTGGCCAAGAACTGGACCTTCCCCAACACCAGAACAGCTGGCAGCTCCAGC

GACCCCTTCCTGTGCCCACCCCGACAACTGGAGGGACTGCCTAGAACCCCCATG - UNI35583 - GCCCTGCCCGTAGACCGAAAACAGAGCGTGGA

TCCCAGCCGCACATCTACACCTCAGGGCCCAGCATTTGGAGGCAGTCGTACCCCCAGCACGTCGGACATGGGCGAGGAAGGCCGAGTGGCCAGCGGGGGC

GCCCCCGGGCTGGAGACCTCAGAATCCCTAAGTGACTCCCTCTATGACTCGCTATCCTCCTGTGGGAGTCAGGGTTGAGGGACCGCACCCACTACAGTTC

CTCTGGAGCTAGGGACCCTCAACGACCTGCTTCCGCGCTCCACGCCCCACGCCTTTGGGCCGGTGAAGCTTGACCTGAAGGGACCAAGGAGAAAGAGGAT

AAGAAGGCGATGGGGGGTCCCTGGCGTATGCCACTGCTGCTGTGGATGCGACAACCATGCTCAGCTCAGGGAGAGACCTCATCCCCAGTCCCTTGACTCC

CCCAGAGTAAGGCTCTGCTCTACGGGACCGGGGGCTCCAGGCTGCTTTGTCCCAGCTCCCACTTCAGGCCGAGCCATCTTGCGGTGCTAGGCTTCCTGCC

CGCCAGCTGTGCCACCTCTGCCCAACCTGGCTGCAACCCTGCCCCAAAGCCCCCATGGGGCTGATTTTGGAAGCCCCAGGCTTATGGAGTTTGGGGGTGA

GGGGGACAAGTCGCCTTCACTCTGCCCTGGTCCTCCCTGCTGTCTGAATGGTGCTGCCTCCCTTCCCCACATCGTGGGGTCTGTTTGTCTGTCTTCATCT

TTGTTTTTATATATATATATATATATAAGCGCCTGGCCCAGTCCCCACCCCTACCCGCACTGCGGTTAATTTATCTGTTGTTGAAAAGCAGCCCTGCTTC

TGCAGCATCCCTAATAAAACGTGGAGGCCTCTCCCCACCGTG
Translation
 - UNI4708 -  MDQPAGGTGKLRASAGEDDSMELSTCQELLHRLRELE AENSALAQANENQRETYERCLDE VANHVVQALLNQK DLREECIKLK

KRVFDLERQNQVLSALLQQKLQLTANSLPQ - UNI32971 - IPLTPLQPPSERPTSPAPNVSEGPATSLPSGLCAGQRE - UNI32971 - VCWE

QQLRPGGPGPPATPPPALDALSPFLRKKAQILEVLRALEETDPLLLCSPATPWRPTGQGPGSPEPINGEPCGPPQPEPSPWAPYLLLGPGSLGALLHWER

VLGGPGEEEGIRQPWASSRAPPSAQGPSSGPHCAPGSSSSSSSDEAGDPNEAPSPDTLLGALARKQLNLGQLLGDTETYLQAFLAGATGPLSGDQPGPGK

PNSPDPGPPQVSKSKGLPKSAWGASTPEATRLGFGATSEGQGPLPFLSMFMGAGDAPLGSRPGHPHSSSQVKSKLQIGPPSPGDAQGPLLPSPARGLKFL

KLPPASEKVPSPGGPQLSPQLPRSSRIPCRNSGSDGSPSPLLARRGLGGGELSPEGAQGLPGSPLPCSAMPDSAQLRPSQSTVSTALSPGPVVSPCFENI

LDLSRSTFRGSPPEPPPSPLQVPTYPQLTLEVPQTPEVLRSPGAPSPGLPESCPYSGPQEKSMDRAGSESPHASRRTPGGSSKKPGQGSGRRPGDPSHTP

LRDRLAALGKLKTGPEGPLGPEKNGVPARSSAEKARALVRSGECAGDVPPSARPLEQPEAKGIFRGAVALGTSSLKQQEPGLTDPGARVYSSHSMGARVD

LEPISPRSCLTKVELAKSRLAGALCPQMPRTPAKVPTSAPSLGKPKSPHSSPTKLPSKSPTKVVPRPVVPLGTKEPPKPDKVKGPPWADCGSTVGQPTSP

VAGPADPSQGSEGPAPHSAIEEKVMKGIEENVLRLQGQERTPGSEAKHRNTSSIASWFGLKKSKLPALNRRTEATKNKDGAGGGSPLRKEVKTEARKLEA

ESLNISKLMAKAEDLRRALEEEKAYLSRARPRPGGPATVPSPGLGQAQGQLAGMYQGADTFMQQLLNR - UNI32971 - RVDGKELPPKSWREPKPE

YGDFQPVSTDPKSPWPACGPRNGLVGPLQGCGKPGK PSSEPGRREEMPSEDSLAEPVSTTHFTA ACGSLTRTLDSGIGTFPPPDHSSSGTPSKNLPKT

KSLRLDPPPGAPPARPPGLTKVPRRAHTLEREVPGIEELLVSGRHPSMPAFPGLLTAPPGHRSHQTCPDD - UNI35583 - DPCEDPGPPPPVQLAK

NWTFPNTRTAGSSSDPFLCPPRQLEGLPRTPM - UNI35583 - ALPVDRKQSVDPSRTSTPQGPAFGGSRTPSTSDMGEEGRVASGGAPGLETSESL

SDSLYDSLSSCGSQG

For any suggestions or comments, please send an email to unitrap@crg.es