Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023020 (2310016M24Rik)
Chromosomal location
Chr 15: 99556078 - 99558545 (+)
Description
RIKEN cDNA 2310016M24 gene Gene [Source:MGI Symbol;Acc:MGI:1913629]
RefSeq_dna
NM_183256 
RefSeq_peptide
NP_899079.1 
MGI
MGI:1913629 
Uniprot/SWISSPROT
Q8BH51 
Human Ortholog
ENSG00000178449 (C12orf62)
Omim not available
UniTrap UNI15820
Vector Insertion
Chr 15: 99556280 - 99558075
Public Clones not available
Private Clones OST472496 (lexicon) OST448224 (lexicon) OST441486 (lexicon) OST419185 (lexicon)
OST309977 (lexicon) OST77958 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023761
Sequence
AGAAGCCGGAAGTTCAAGGCTGGCTCTCGCTTTAGTGGGCGAGTTTTCGCAGGGGGTGTCGGGTCCGGAGCGGGGCTGAGCACCAGTGGCTGAGGAGCTG

CGCGTTGGTGACTGCCTCTTCCTGCCCTGCGGCGGCCGCGCGACTCTGCGAGTGGCAGACTGAGCAGGCATCGCTCTGACGCGGCCGAGTTGCAGCCTCC

AG - UNI15820 - GGGAAGACATGCCATCTGCCAAGCAGCTAGCCGATATCGGCTACAAGACCTTCTCTGCCTCGATGATGCTCCTCACTGTGTATG

GGGGTTACCTCTGCAGTGTACGAGCCTACCGTTACCTCCAGCTGCGCAGTGCCAGGCGCCAGGCTGCAGAAGAGCAGAAGACCTCAGGAGTCCTGTAGAG

CAGCGAGGCGTGAGGCCTGCGGCCTGAAATGGAAAAGATTTTCCTGCATGTCAACCCTGGCAAGAACTAGGCCCCCATGCCTTTCAAACCTGCTGGGCTA

AAATGCCTTGGTTTCTGTAGTGCTACTAGCTTGTGCCGTTCTGACAGTTTATGGAGGCCATCAAGTAAATGGGAATGTGAGGGTGAGGTTTATTACAGAG

ATTAAATATTTTGCTTTGTTTGTGTTTTAGTGGTTCTGTGTACCCAGAGAGTAAATGGATCATAGAGGTGTGGCTTTGAGTTCTCT
Translation
 - UNI15820 - MPSAKQLADIGYKTFSASMMLLTVYGGYLCSVRAYRYLQLRSARRQAAEEQKTSGVL

For any suggestions or comments, please send an email to unitrap@crg.es