Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023032 (Slc4a8)
Chromosomal location
Chr 15: 100592178 - 100654402 (+)
Description
solute carrier family 4 (anion exchanger), member 8 Gene [Source:MGI Symbol;Acc:MGI:1928745]
RefSeq_dna
NM_021530 
RefSeq_peptide
NP_067505.2 
UniGene
Mm.209856 Mm.408499 
MGI
MGI:1928745 
Uniprot/SWISSPROT
Q8JZR6 
Human Ortholog
ENSG00000050438 (SLC4A8)
Omim not available
UniTrap UNI22961
Vector Insertion
Chr 15: 100605143 - 100613376
Public Clones IST14446H1 (tigm)
Private Clones OST280153 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34976
Vector Insertion
Chr 15: 100617784 - 100618590
Public Clones IST12901H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33477
Vector Insertion
Chr 15: 100620354 - 100621336
Public Clones IST12709C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023776
Sequence
GATTGGCTGCTGCGGGCGCCTCGCGGGCTGATGGCTATGAAGGTGGCGCCGGTTGATGGTTGACCGATCCTTGGATCCAGGGTAGGGGTCGCTGCGCGTG

CGATCGTCTCACACTGGACTACAGGGCGCGGACTGCTGCAGCTCAACCTGGAACCTACCGGCGAGACCAGGCTCCGCCCGGCCATGCCCGCCGGGAGCAA

CGAGCCGGACGGCGTCCTCAGCTATCAG AGGCCAGATGAGGAAGCTGTGGTGGATCAGGGTGGGACCAGCACAATTCTCAACATTCACTATGAGAAAGA

AGAGTTGGAAG - UNI22961 - GTCATAGAACTCTGTATGTGGGGGTTCGGATGCCGCTGGGGAGGCAGAGCCATCGGCACCACCGCACTCATGGCC

AGAAGCACCGGAGACGAGGAGGGCGGGGCAAAGGAGCCAGCCAGGGCGAGGAGGGCTTGGAAGCCTTGGCCCACG ACACCCCGTCTCAGCGTGTTCAGT

TCATTCTTGGCACTGAGGAAGATGAAGAACATGTGCCTCATGAGCTCTTCACAGAGCTGGACGAGATCTGTATGAAAGAGGGGGAAGATGCTGAGTGGAA

GGAGACGGCCAG GTGGCTGAAGTTTGAAGAGGATGTGGAGGACGGGGGAGAGCGCTGGAGCAAGCCTTACGTGGCCACGCTCTCTCTGCACAGCCTGTT

TGAGCTGAGGAGCTGCCTCATCAACGGCTCTGTGCTTCTGGACATGCGTGCAAGTAGCATAGAGGAGATCTCAG ACCTGATCCTGGACCAGCAGGAGCT

GCTCCGAGACCTGAGCGACAGCGTGAGGGTTAAAGTGCGGGAAGCCCTGCTGAAGAAGCACCACCACCAGAACGAGAGGAGGAGGAACAACCTCATCCCC

ATCGTCCGCTCCTTCGCTGAGGTTGGCAAGAAGCAGTCTGACCCGCACTCCATGGACAGAGATG - UNI34976 - GGCAAACGGTGTCTCCTCAGTC

AGCTACAAACCTTGAAGTGAAGAATGGTGTGAACTGTGAGCACAGCCCTGTGGATCTAAGCAAG GTGGATCTTCACTTCATGAAAAAAATTCCCACGGG

GGCAGAGGCCTCCAATGTCCTGGTGGGAGAGGTGGATACGCTGGACCGGCCCATCGTGGCCTTCGTGAGGCTCTCCCCGGCTGTGCTGCTCTCTGGCCTG

ACGGAAGTGCCCATCCCAACGAG GTTTTTGTTTATCTTACTGGGCCCAGTGGGAAAAGGGCAGCAGTACCATGAGATTGGCAGGTCCATGGCCACCATC

ATGACGGACGAG - UNI33477 - ATTTTTCATGATGTGGCATATAAAGCAAAGGAACGCGATGACCTCCTGGCAGGGATTGACGAGTTCCTGGACCA

GGTGACGGTGCTTCCGCCAGGGGAGTGGGACCCATCTATTAGAATTGAGCCACCCAAGAATGTCCCTTCCCAG GAAAAAAGGAAAATGCCCGGTGTTCC

AAACGGAAACGTTTGCCACATAGAACCAGAGCCACATGGGGGGCACAGTGGGCCAGAACTGGAGCGGACTGGGCG GCTGTTTGGGGGCTTGGTGCTGGA

TGTCAAGCGGAAGGCTCCCTGGTACTGGAGTGACTACCGGGATGCTCTCAGCTTACAGTGTCTGGCCTCCTTCCTGTTCCTGTACTGTGCCTGCATGTCG

CCCGTTATCACCTTCGGGGGACTGCTGGGAGAAGCCACTGAAGGACGCATA AGTGCGATTGAGTCGTTGTTTGGAGCGTCCATGACGGGGATTGCCTAC

TCTCTGTTTGCTGGGCAGCCTCTCACCATCCTGGGAAGCACGGGGCCCGTGCTGGTGTTTGAAAAGATTTTGTTCAAATTCTGCAA GGACTATGCCCTT

TCGTACCTGTCCCTGCGGGCTCTCATCGGGCTGTGGACTGCCTTCCTGTGCATCGTCCTGGTGGCCACGGATGCCAGCTCCCTCGTCTGCTACATTACCC

GCTTCACCGAGGAAGCGTTTGCCTCCCTGATTTGTATCATCTTCATCTATGAAGCCATAGAAAAGCTGATCCACCTGGCAGAGACCTACCCCATCCACAT

GCACAGCCAGCTGGACCACCTGAGCCTCTATTA CTGCAGGTGTGTGCTCCCGGAGAATCCAAACAACCACACCTTACAGTATTGGAAGGACCACAACAT

CCTGGCTGCCGAAGTGAACTGGGCAAACCTGACAGTCAGC GAATGCCAGGAGATGCACGGGGAGTTCATGGGATCTGCCTGCGGTCACCACGGACCCTA

CACGCCCGACGTGCTCTTTTGGTCCTGCATTCTGTTCTTCGCCACCTTCATCGTCTCCAGCACCTTAAAGACATTTAAGACAAGCCGCTACTTCCCGACC

AGG GTCCGCTCCATGGTGAGTGACTTCGCCGTGTTCCTCACCATCTTCACCATGGTGGTCCTTGACTTTCTGATTGGCGTCCCGTCGCCAAAGCTTCAG

GTTCCCAATGTGTTCAAG CCAACAAGGGACGATCGAGGATGGTTTATTAATCCCATTGGCCCCAATCCCTGGTGGACTGTGATAGCCGCAATTATCCCA

GCTCTCCTGTGCACTATCCTGATATTCATGGACCAGCAGATCACCGCTGTCATCATTAACAGGAAGGAACACAAGCTCAAG AAAGGCTGTGGCTACCAC

CTGGACCTGCTCATGGTGGCCGTCATGCTGGGAGTTTGCTCCATCATGGGCCTGCCTTGGTTTGTGGCCGCGACCGTCCTGTCCATTACCCATGTGAACA

GCCTCAAGCTGGAATCCGAATGCTCTGCCCCCGGGGAGCAGCCCAAGTTCTTGGGCATCCGGGAACAGAGAGTCACAGGGCTTATGATCTTCGTGCTGAT

GGGCTGCTCAGTCTTCATGACAGCTGTCTTAAAG TTTATCCCGATGCCAGTGCTCTACGGAGTTTTCCTCTACATGGGAGTCTCTTCGCTACAAGGAAT

CCAG TTCTTCGACCGTCTGAAGCTTTTCGGGATGCCTGCAAAACACCAGCCAGACTTCATCTACCTGCGGCACGTGCCGCTGCGCAAGGTGCACCTGTT

CACGCTAGTGCAGCTCACCTGCCTCGTCCTGCTCTGGGTCATCAAGGCATCGCCGGCCGCCATTGTTTTCCCAATGATG GTGCTGGCCTTGGTCTTCGT

CAGGAAAGTCATGGATCTCTGCTTCTCCAAGCGTGAGCTAAGCTGGCTGGACGACCTCATGCCTGAGAGCAAAAAGAAGAAGCTGGACGATGCGAAGAAG

AAGGAGGAGGAG GAGGCCGAGAAGATGTTGGACATTGGGGGTGACAAGTTTCCCCTGGAAAGCAGGAAGCTGCTAAGTAGTCCTGGCAAGAGCAGCAGC

TTCAG ATGTGACCCTTCTGAGATTAATATATCAGATGAAATGCCTAAAACCACGGTCTGGAAGGCTCTCAGCATAAATTCCGGAAATACAAAAGAAAAA

AG CCCCTTCAACTGAGAGTCTCTGCTGAGTGGAAGATTTGGACCATGAGGTGCCTCGGAGAAGTTCTGGGTTTTAACAAAATGGCGAGTCTCTCCGGGA

AGAAGCCGAGCTGAGTCTGGCCCCGTTCTTGGTCATCTCAAAGCCATGCCACATGGAAGCATTCAGTCACTCCCGGTGTGCGTTTGGAGGACATCCAGCT

ACCCACATACCAGCAGCCAGGCGCCAGTCGGGTCATGGTGGGGCCGCCTCCCGCTGCCTCCTTTCCTCTTCCTTCTCTCTCTTCAGAGCTGCCATCATTA

AAGAGCCAGCTTCCATTTTCAGACATTTTCTCTGATACTCTGCTGGCCTGGTAAGCCACACGAGTCCATTCTGTCACAGAGGATTCCCTCTTCCGAACGA

TAGCCTGGGGTAGTGGCAGAGGCAGGACAAGGGCAGGCTCTCCAGCAGCCTGTGCCTTGGTTTCCTTTCTGCCTGGGAAGGGGATGTTGGACAGGCAGAC

ACAGTAGCAGGTCTGCTGCCTGAGCTCCACCATCCAGGCATCAACAGCAACCACCACAGTGAGCTGCCTCTGGCCTGGGGTCATCTGCATCACCTCCAGA

AGCAGTGGGCATAACGTTGTGAGTCCTTGGAAGATGCGGGGACAGCATGAGAGCAGGAGTTTAGCTGATGTCAGGAAAGGCCTAGGGGAAGCCAGCAGCG

CTCGGAGTGTGAGCATCTTTCCCTGGAACGAGAGAAAGAGGAGCCTAACTTGCTATGGAAGCACTTAGGTTTCCAGGCCTGGAGATCTGTTCCAGGTCTG

TTTTTTTAAGTCTAGGAAAGTCTTGCTGACAGCTGTTTGTAGGAAGGAAGGTGGATCGGGGCTGCTGCGGCTGCTCTGTGTGAACTGTTTGACTTGATGC

TGCTACCTCTCGTGGTGACATTGTTATAACACCCTGGAGAGACCCGAGTGCTCATGGATGTCCCTTAGCTGCCTTAGTCGGGAGAACCATCATCATCCAC

TCGGTGGACCCAAACCGCCATCAGCCATGTGACTTCCTAATCATGGGTTTCTTTTGGTTGACAAGTTCTGGCTCAGGTGTAAAAGCCACACGAAGAAATG

AGCTGTAAGCGGTGGCATCACTTTGGATACTTAGTTTAAAAGTATATGTGTGATTTTCTATGTTCCAAAACTATCATGAGTTTTTTGGCCCGAGCAAGTG

TAGACCTCCCCTTCCTTTGTGCCCAGACTGTGACTAGTGAGCTGGGACAGTCTCTGTCCAGAGACCACACACACACAGTGAGCTCTCTTCCTCTCCTGGC

TGAAGAGGCTCTACATCATTCGATCACAGTTTGCTCCCCCTCAGACTCGCTGAAACATCTAGTCCTTCTCTGAAGGTCTTAGGTGTCGGGGGCCACCCCG

TGTTGCCCGTTCCTCCCTACCTGTCAGGACCACTGCCATATTGATGCAAGATATTTGACAATTGATACAGGACAGACACGAGCCACACAGAGCCGGTGTC

TTCTGTAGAATAGTGGTGGGCACTGCTGTTCAGGGCCTGTGGGATGAACGTGACCCTGCTTCCGATCCCAGAATGGCCTCTGGAATGTGGGTTTGTCTGG

TCTTTACTCATGGGAGATGTGCGTTCCATCTGAGCAGCCACCCTGGCTTGCTCTCAGGTAGCACATACTGCAACAGGTGGGTTTCCTAGAAATCAGTGGA

CATTCAAGTCTCTGTTAGCCAAACAGCCCAAGCATGTCACTTGAGGACAGATTTAATAAGCATAGCCTTGCCCACCTTGGATTAGGAGCCGGCCTGTCAG

TGGGAAAGGTTTTTGATGCCTTCCTGGCCCTCCTCACACTTCTGGAACTCGAGTCTTTTCTCACTGCTTGCATTCTCTGGGAACACCCCTCTCTTCCCGG

ACTGGTTTCTCCTCTGTTTTTCCTGCCACCTTCTGTGTAGGGAAACTGATGACTGCTTCACCCTGCCCTGGCCTCAGTGCACTTGAGAGACATAATGGTG

AGGACCCTGACGTATGAGGGAGCCAGTGACTTGTCACTGAAACTTACTCTTCCCACACGATGACGCTTGTGCAGCCTCCTGTGAGCTATGCCCTGGGCTG

GAGGGTGGAGGCTGCTCTCGCCCGCCCTGAGCAATGCACTTGTGGAGCCTCATGCCCATGTTTGCACTGGTCATCTCTTCTATGACAAGGGTCGCTCTCA

GACACGTCTTGAATGTGGCCAGCTAATGTCATGACTTGCTGGTAATGTCAGCTGGTGGTGTGAGTGGAGTTGGGGGGCTGGGACTCAAGAACACGTTAAT

TGAAGCCTTGGCTCTGAGGGAAAAGATGGAGGGTTCCTAAGTGGCCAGTTGCTTCCCGATGACCATCAGGGAAGGGTTGCTGTAGAGAAAGGTGAAGAGC

TGGAGAGACGGAATGTGCAAGTGCCAAGTGTGTTTGGTTGCATAACACATGCAACTTGGGAAGCTTTGTCAGGAGGCTCCGGACTTTCCCACTCCCAGCC

CCATGTTGGGTCTCCTTAACCATGAAAACCTGTCTTCCCGATAGAGGGAAAGTGAACCATCTCTCTCCAAAAGACAGTTGCGGTTTCTCATTGTCGGTGA

TGGAGCAGACTTTTAAATTACTCACTAATGTTGGATGAAAATGTGGTATTCACTAAGTTCCCAGCCTGCCCAGACTCTGCAGAGTCTGTGGTTTATGATC

GTCCAGAAAAGGACAGTTCCTAACTCCACTTTTCCTTGACCTGCTCAGCTCAGCAGACCTGCTCCTTAGTGGGGAGGCAGGGGTTCTCCTTGTATCCTGT

GTAGTAGGTGCAGTGTCTGTCCTGCCTCTCCACTTGTCCTGGGTTGTAGTGAGTAGCAGACACACTGTCTCCTGTGTGTCTCCCACCACTGGGCCGCTCG

ATGTCCCTGAAGATCTTTTGATGTAATTTAATCGTATGGGTGTTTTACCTTCACACAGGCCTTTGCACCACATGTCCCCCATGCTTCAGGAGATCAGAAG

GAATCCGATCCTCCTGGAGCTGGAGTTACAAATAGCTGTGTGCTTCCATGTGGATGCTGGGGATTTAATTGAACCTGGGTGTAGCTGGTCTTTGCTACTT

TGTGGGTTATTTTCTCACCCTTTGCTCCCTCTCCCAGTTTCACTCCTTGACACTAGATAGGACAAAAACGGGGGGCGAGAGGGAGAGGGAGAGAGAGAGA

GAGATCGAGATCAAGAGAGACACCCCTGTATCTAAATTCCTTTCTTCTTTGAACACTACGAAGAAACCACAACCAACCACACACAACTCCCAAACAACCA

ACAACCACCCATCCTGCTTTTTGGGAGCCTAGCATTTATAGACTTTCTGAAAAGTTCCTAGAATTCCAAAACTTGACACAATGCCAGAGACTGTCTGCAG

CTGGCAAAACCACACTTCTGCTAGAGCACTAGGCAAATCATGTCAGCTGCTGCCGACACTCCAAAGCAGCCCCACATCCCCACACCTGGGGACTAAAATG

ATAACATATTCTTATATTTGTTTTTTAAAGAAACCAGAATTCCAGAGTTCTCACCACGATTCCCCACTTCTGTTTTAAGTCATTAATTGTGCTGTGTATA

TCAGGAAATTATAAACAGACATTTTCAAGGAACTGAGTGTTCAGGTTAGTGCCAAGGTGTTGAGGAGACCTCTCCTGCTCGGTCCTAATCTTTATCAGTT

TTGATGGTATCCACAGCTTTTCGTTTCCTGTGGAAGTATAAACAATTCCCCATCCCCAATGCAAAACTTTTCTGTTCTAATATTAACACATCTTTATTCT

ATATTGTAAAAAATTCAGTTTTTCCTCTCGGCCCCTGCTCCAGGAATGACCACTCCAAGACTCCTTATTATTAAATGCCTTGGCCAGAAGCCTTGCCTCA

TCCATGACTGGCTCGTAACCTATTCAACCCATTCAAACTCTTCTATGTCATCCTCATGGTTACTTCTCCTCAGTCCCGGCTTGCTTCATCCTTCTCACTA

CCTCCTCCTTGTCTCACTATCTCCCAGAATCCTCTCTTCCTGCCATTGTCCCACCTCCTATTTCTTGCTTCAGCTCATTGGCCATTGGTGGTTTTTATTG

ACAAGAGATGCTAATAAGAGATTCTACAGTACATAGGCTGATGTAATTCCACAGTTTTTTTTCTAAAACCCAGAGTATCTCAACTGCTGCTGTTCCTTTC

TCATTAATATTCAGAAAATTTAAAGTTAGCAGAGAGTAATTGTCTCTTTTTTTCTCTTTGCTTTATAAGCATTTCCTTTAGGTAAAATGAGATCTTTCTA

CAACTGCCTGTCCTGTAGGATTGCATGAATATTAATCTGAGCACTGCACAGTTGTAGAAGAGCCCTTCCCCATAGACTGATGGGTCGGTCAGAGTCCTTC

CCCATAGACTGATGGGTCGGTCAGAGCCCTTCCCCATAGACTGATGGGTAGATCAGCCACATCAGGTCTTAGCTTTCCTGTTAGACCTTCTGGTCCCACA

CATTTCACCCATTGCACACTTTGTTTTATCTGAGATAAATTTCCGATTCCTAGAAACTGTATAAACCTTCCAAAGTGGCCATTCTGAATTCCAAGATTTT

TTTGTGAACTGATAGTTACATCAGCGCCTGTATCCACAAATTTGTCTACTTCAGTACCTTTTATGTGAAATTTTAATATTTGCCTCTGATCATTAACAAC

TGTTTGCCGGAACACATGCTTTTCAGTCCTTTCAGACCCTCCTGTTCTCTCTACTGGAGCAGCTTTGTCTCTGGGACAGGGAAACAGTAGCAGCCGAACA

AGCCTCTATCACCTGCATTAATTTGCATCTCTCTCCCTCTCCCTCACACACACACATGCCATAACTTTAATTTCTCCTTTGAAATCTTCATGTATGATTC

CTGGGTGCACAGTGAATCCTTGGGGAATCAATCCATCTATTCTCAAGATCATCCCACTGTCTCTGCAGGCAAAGGAGCACGAACTCTCTCGAAGTTTTGG

ATATAGAGTAATGCTTTTCTGTGGCCGAGTCTAGAGCAGCACTGCCTGCAGAGGTGTTAGATCTCCAGTGCTGAGTGCAGGTTTTAGTCTGCGTGTTATG

GCTTGACTGGAACAGCTCACAGTCTTTGCTTGGTGGGGAGCTAAGCTAGGCCCCCAAGGCTGTTTCCTTGAATATCTCTTTTGGATCTGCATTCCGGAAT

CCAGTGGCTGCCTTTGCCAAAGTGCATACACATTGCAGGAAGCCTACGAGTCCTGTTTCAGATTCAGGAAAACCATTGCCTCTAGAAATGACTGATTCAC

TCTTCTGCTGCAAAGTACTGTCTTTCTCCCAGTTAACGCACTGGGTGGGTATTTTGAGGTCAGAGATTTTTAGCTCTAGCTTGGCCTGTTCTATTAGCGT

GGTACACATTAGAACCAATATCGATCACATCCCTTATCCATTCTGCCATAGACGCTTGCTCGAGCCTTTAACGTTTCGATAACTTTTTTGCATTTGGTTA

TTCGCCTTTTCAACAACTAAGGCCTCTATCAACACCTGCCTTCATCTTGATCTGGTACGGCTTCCTTCACAGCTGAGACTAATCTTTGTAATCAGTGAAG

GCTTCTCAGAAGCCCTGTATAATCTTTATAAATGAGGTGGTCTTTTTCCTGGGCCCCTCAAATTTGTCCCAAGTTTTAAAGCCACCAAGCAACATTGTTC

AGTAGTAATATTATGTGATTGAACCTGTTCTTGTATATCAGAGCCCTGCCCTTCACCCAGCAATGGTGGAGCTGATGGGATTCGGCTCAGAGAGCTGCCG

CTGGAGCTGCTGCTTGTGGTGCTAAGGACTAGAGAATGATGGGAAAATCCTACACTGAGTGGCTGAAGCAAGGCAAGCTCCAACAACTTTGTTTTCTCCT

TCAGCTCGTTTGTACCCAAAAGTGGTCACCACAAAACACTTTTGAAAAACATGTTAAAATCACTACACAAACTGAAATTACAACAGGATTACTGCTTGCA

TATCCTTCTTTTGGAACTTTGACCTAACTCTACATTCCTCATCTGTCTTTCTCTCCACAAGTTCACTGCCACCCCAAAGCAATAATTCTCTTGTCATAGA

CTAACAAAGCTTAAGCAGACCAAGTAGAGAGTAGTATGTTTCTCCCAGTGCTTAGATGGTGACAATCTTGTTTGCTAAGGAACAGGTCATCTGTCTTGCA

TCTTGTTTTTGAAGTCTTGGTCAGCTAGACTGGCTAGTCCTCTCTCTCTGTTCTTACATACACAGTGAAGTCCCCTGCTCTTCGTTCATGACCTTCCTTC

TCATGGTGCACACAGAAACCAGTGCCACACCTCTGGATCACAAGATCAAGGAACTTAGACCCAACCTGGAATGAATGTCTTGTTTGATAATTAACTTGTC

CCCAGCCTGTTTTTCTTGCTCCTACAATCGCGCGCTTGCAACGCTGAGGGCTCACTGGCGCCCTCACCTGTGCCAGTCTATGAGAAAGGGCCACACTCTG

TTCTCGATTCGAACTTTGAACTTTCTATCAAATACTCTTAACTTCCCCAAAATTTTAAATTAAACTAACTTCCCCAAACTACTTTAAATTGGGAATTCCA

TAAAATCATTAATTCATGTAAGCAGCATTATCTCAGGAATGTTCATCTTCAGGTTGATCTTCAGGAAACTTGCCCCACAGAGTGGGCTACCACCCAGAAG

TGGTCACTCCAGGCTACGGAGGCAGTGAGTGTCTCACTATGTCAAGTACATGAGGGATATAGCAGTGACAAACATGAGAAGGCACAGCAGTAGCAAGAAG

CATCCCTGGGACGAAGCCCCTAGGGCTGGACATCTCCAGGGCACACCCACCCATCACAGCCAAGCAGAGCTGCAGGCTCCAGGGCACACCCACCCATCAC

AGCCAAGCAGAGCTGCAGGCTCCAGGGCACACCCACCCATCACTGCCAAGCAGAGCTGCAGGCTCCAGGGCACACCCACCCATCACTGCCAAGCAGAGCT

GCAGGCTCCAGGGCACACCCACCCATCACAGCCAAGCAGAGCTGCAGGCTGGCTCCAGGAAGCTCACTTGCCCACTGCAGCTCCCCCTGCATGGCGTTCA

CCGTCCCTTGGAGGAAAGAATCCCACTCGGAGCTCCTCACTGTGCCACAGCTAAGGCGGCCGCTGATGCTCCCAGGAGAGGGACTGGATGGCTATGTTCT

GACGTGACAAGTTGAGGGACTGAGAATCCTTAAGCTCCCATGCTCACCTGTATTGATCTCCATTCACCGTAAACAGAAAAACACGTCCAGAGGCCAAATA

GAGGCAAACTTTCTACTGTAGATAAAAATGACTCTTGGTATCTGCCTCCAACAGCCTTGGTTTTTCAAGGCAGGGTCTCACTGTGTAGAGCAAGCTAGCC

TTGACCTTGCTGTAACTTTCTTGCCTCCCAGCCGCTGGGTCAAGCATGCACAACCATACCTGGCTTTGCCCTTGGTCTCTCTTAGGCGGACTCAGTTCTT

CTTCAGTACCTTTTTCTTTGTGGCCAGAAAGGAGAATTCGTGAAGTAATGCGGTTTGGAGTGCATGAGAGGAATGCCGTCTTCTCATTCACAGGCATAAA

TTGTCTTAGGTTCTGTGCTCAGTGGGAATGGATTGGTTTGCGCGCGGGGGAGCGGGGGGGGGGGGCCGAAGAGAAGAGGAACAGCGTCCCCCACTCCAGA

GCTAACCCACCCTGAGGATCAGAGGATAGAGTTTTCCACTAAGCAGGGTTTCCTGAGCAACAGGGAGGCCCTCCATCCCTCACACCCACAAACCTTTTCT

AAGCCCAGAAGCAGTCTTGACGTGGACATCGCTTTCAGGGTTTATGGGTGACTTCAGCGTGCATGGTTTCACTTGTGCAACAGTGCGAGGCACCAGCCTG

AGTGTGCAACCTCTCCTTTTGTGAAAGAAACCAAAATTCTTCCTGTGTCTCCTCCTCTCTGGTCTCTGTGTGTTGATTGGTTAGAAGTGGCTGATGGTGT

CCCTTGGAGAGCAGAGCAACCTTCCCATGGAAGGGGACACTTTGAGGTGCTGGTGTGTCTCCCTCATTTTCTATGTTCTTCTCTCTAGTAGGTCTCAAGT

AGAGACAGATATTTTTGTTTTAGAGATTCCAAAGTCTATATTTTTAGTGTAAGAAATGTACCCTCTCCACACTTCATGTCGTAAATAGAACTGGGAATAA

GATGTGCAATTGTGATCACCCTGTAACAATGTATGGTAGACATGAGGCCCCGGGGCAGGTGACTTGGTGTGTCTCTGAGCCCTCCTCTCTGCCTGCCCAC

ACACATGTGTGCTCAGCTCTTTGAGTGACAAATAAAGCCCATGTTATAAACTGATT
Translation
MPAGSNEPDGVLSYQ RPDEEAVVDQGGTSTILNIHYEKEELEG - UNI22961 - GHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGGRGKGASQGE

EGLEALAHD DTPSQRVQFILGTEEDEEHVPHELFTELDEICMKEGEDAEWKETAR RWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGSVLL

DMRASSIEEISD DLILDQQELLRDLSDSVRVKVREALLKKHHHQNERRRNNLIPIVRSFAEVGKKQSDPHSMDRDG - UNI34976 - GQTVSPQSA

TNLEVKNGVNCEHSPVDLSK VDLHFMKKIPTGAEASNVLVGEVDTLDRPIVAFVRLSPAVLLSGLTEVPIPTR RFLFILLGPVGKGQQYHEIGRSMAT

IMTDE - UNI33477 - IFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQ EKRKMPGVPNGNVCHIEPEPHGGHSGPELER

TGR RLFGGLVLDVKRKAPWYWSDYRDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRI SAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVF

EKILFKFCK KDYALSYLSLRALIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASLICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYY YCRCVL

PENPNNHTLQYWKDHNILAAEVNWANLTVS ECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFATFIVSSTLKTFKTSRYFPTR VRSMVSDFAVFLTI

FTMVVLDFLIGVPSPKLQVPNVFK PTRDDRGWFINPIGPNPWWTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLK KGCGYHLDLLMVAVMLGVCS

IMGLPWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAVLK FIPMPVLYGVFLYMGVSSLQGIQ FFDRLKLFGMP

AKHQPDFIYLRHVPLRKVHLFTLVQLTCLVLLWVIKASPAAIVFPMM VLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAKKKEEE EAEKMLD

IGGDKFPLESRKLLSSPGKSSSFR RCDPSEINISDEMPKTTVWKALSINSGNTKEKS SPFN

For any suggestions or comments, please send an email to unitrap@crg.es