Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023033 (Scn8a)
Chromosomal location
Chr 15: 100701114 - 100876360 (+)
Description
sodium channel, voltage-gated, type VIII, alpha Gene [Source:MGI Symbol;Acc:MGI:103169]
RefSeq_peptide
NP_035453.2 NP_001070967.1 
UniGene
Mm.396661 Mm.409617 Mm.385012 
MGI
MGI:103169 
Uniprot/SWISSPROT
Q9WTU3 
Uniprot/SPTREMBL
Q4KL32 Q3TYI3 
Human Ortholog
ENSG00000196876 (SCN8A)
Omim not available
UniTrap UNI26909
Vector Insertion
Chr 15: 100701175 - 100766701
Public Clones not available
Private Clones OST86549 (lexicon) OST32312 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21539
Vector Insertion
Chr 15: 100785962 - 100787461
Public Clones not available
Private Clones OST326555 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30196
Vector Insertion
Chr 15: 100788021 - 100789770
Public Clones D082G10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38006
Vector Insertion
Chr 15: 100814507 - 100832491
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096198
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA CCTCAGCTGGCTCAGCTGTCCCGATGCCGGTAG
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK PQLAQLSRCR
Transcript ENSMUST00000108907
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA ACTTTTGTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCCTTTTAACCTGATAAGAAGAA

TAGCTATTAAAATTTTGATACATTCAT - UNI21539 - TCTTCAGCATGATCATCATGTGCACCATCCTGACCAACTGTGTATTCATGACTTTTAGT

AACCCTCCCGAATGGTCCAAGAATGTGGA GTACACATTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGAC

GGCTTCACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGC - UNI30196 - ATATGTGACAGAGTTTGTGGACCTGGG

CAATGTCTCAGCGCTGAGAACATTCAGGGTTCTCCGAGCTTTGAAAACTATCTCTGTAATTCCAG GCCTGAAGACAATCGTGGGCGCCCTCATCCAGTC

TGTGAAGAAGCTGTCAGACGTGATGATCCTGACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG

TGTGTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGGAGTATATCAACAATAAAA CAAACTTTTAC

ATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAGCTCTGACGCCGG GCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCC

AACTACGGCTACACCAGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGAACTTATACCAGCTG ACC

TTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGTGGGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGG

CTTACGAAGAGCAGAACCAGGCAACACTGGAGGAGGCAGAGCAGAAAGAGGCAGAGTTCAAGGCGATGCTGGAGCAGCTCAAGAAGCAGCAGGAGGAGGC

GCAG GCTGCTGCAATGGCCACTTCGGCGGGCACCGTCTCAGAAGATGCCATTGAAGAAGAAGGGGAAGATGGGGTAGGCTCTCCGAGGAGCTCATCTGA

GCTGTCTAAACTCAGTTCCAAGAGCGCGAAGGAGCGTCGGAACCGACGGAAGAAGAGGAAGCAGAAGGAGCTCTCTGAAGGGGAGGAGAAGGGGGACCCC

GAGAAGGTGTTTAAGTCAGAGTCGGAAGATGGCATGAGAAGGAAGGCCTTCCGGCTGCCAGACAATAGGATAGGGAGGAAATTTTCCATCATGAATCAG 

TCGCTGCTCAGCATCCCAGGCTCGCCCTTCCTTTCCCGACACAACAGCAAAAGCAGCATCTTCAGCTTTCGGGGTCCTGGACGGTTCCGGGACCCCGGTT

CGGAGAACGAGTTCGCAGACGACGAGCACAGCACAGTGGAGGAAAGTGAGGGCCGGCGCGACTCGCTCTTCATCCCGATCCGCGCCCGCGAGCGCCGCAG

CAGCTACAGCGGCTACAGCGGCTACAGCCAGTGCAGCCGCTCGTCGCGCATCTTCCCCAGCCTGCGGCGCAGCGTGAAACGCAACAGCACCGTGGACTGC

AATGGCGTGGTGTCGCTCATCGGGCCTGGCTCGCACATCGGGCGGCTCCTGCCTGAG GCAACAACTGAGGTGGAGATTAAGAAGAAAGGCCCTGGATCG

CTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGAAGGACAGAATCAACAGTATAATGAGCGTTGTCACAAACACACTAGTGGAAG AGCTGGAA

GAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGTTTGCCAATACTTTCCTCATCTGGGAGTGTCACCCCTACTGGATAAAACTGAAGGAGATTGTGA

ACCTGATCGTCATGGACCCTTTCGTAGACTTAGCCATAACCATCTGCATTGTCCTGAACACACTATTTATGGCAATGGAGCACCATCCCATGACGCCACA

ATTCGAACATGTCCTGGCCGTAGGGAACCTG GTGTTCACTGGGATCTTCACGGCGGAAATGTTCCTGAAGCTCATAGCCATGGATCCCTACTATTACTT

CCAAGAAGGCTGGAACATTTTTGACGGATTTATCGTCTCCCTCAGTTTAATGGAGCTGGGCCTTGCAGACGTGGAGGGGCTCTCAGTGCTGCGATCTTTC

CGATTG CTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCCACCCTGAACATGCTGATCAAGATCATTGGGAACTCCGTTGGCGCCCTGGGCAACCTGACC

CTGGTGCTGGCCATCATTGTCTTCATCTTTGCCGTGGTGGGGATGCAGCTCTTTGGAAAGAGCTACAAGGAGTGCGTCTGTAAGATCAGCCAGGAGTGCA

AGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTCATCGTCTTCCGAGTGCTGTGTGGGGAGTGGATCGAGACCATGTGGGATTGCATGGA

AGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGATGGTCATGGTCATCGGCAACCTGGTG GTGCTGAACTTATTTCTGGCCTTGCTTCTGAGCTC

CTTCAGCGCAGACAATCTGGCGGCCACGGACGACGACGGGGAAATGAACAACCTGCAGATATCGGTGATCCGGATCAAGAAGGGCGTGGCCTGGGCCAAA

GTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAACGGGAGGCTGATGAAGTGAAACCTTTAGACGAGCTGTATGAGAAGAAGGCCAACTGCATCG

CCAACCACACCGGCGTGGACATTCACAGGAACGGCGACTTCCAGAAAAATGGAAATGGCACCACTAGCGGCATCGGCAGCAGCGTGGAGAAGTACATCAT

CGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTGACCGTGCGGGTGCCCATTGCTGTGGGCGAGTCTGATTTCGAGAACCTCAACACAGAGGAT

GTTAGCAGCGAGTCAGACCCCGAAGGCAGCAAAGAC AAACTGGACGATACCAGCTCCTCAGAAGGGAGTACCATCGACATCAAGCCTGAGGTGGAAGAA

GTCCCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACGCCTGCTTCACGGAGG GTTGTGTCCAGAGGTTCAAGTGCTGCCAGGTCAACATCGAGGAA

GGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCTTCCTCATTGTGGAGCACAATTGGTTTGAGACCTTCATCATTTTCATGATTCTCCTCAGCA

GTGGAGCCCTG GCCTTCGAGGACATCTACATTGAGCAGAGGAAGACCATCCGTACCATCCTGGAGTATGCGGACAAGGTCTTCACCTACATCTTCATCC

TGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAAGTTCTTCACCAATGCCTGGTGCTGGTTGGACTTCCTCATTGTGGCT GTTCCATTAAGTT

TGTCTGGCTTAATTTAA
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSF - UNI21539 - FFSMIIMCTILTNCVFMTFSNPPEWSKNVE EYTFTGI

YTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMA - UNI30196 - AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKL

SDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKT TNFYMVPGMLEPLLCGNSSDAG GQCPEGFQCMKAGRNPN

YGYTSFDTFSWAFLALFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEA

Q AAAMATSAGTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQ

 SLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVD

CNGVVSLIGPGSHIGRLLPE ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMSVVTNTLVEE ELEESQRKCPPCWYKFANTFLIWECHPYWIKLK

EIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNL VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSV

LRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETM

WDCMEVAGQAMCLIVFMMVMVIGNLV VLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEK

KANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKD KLDDTSSSEGSTIDI

KPEVEEVPVEQPEEYLDPDACFTEG GCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGAL AFEDIYIEQRKTIRTILEYAD

KVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVA VPLSLSGLI
Transcript ENSMUST00000108908
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA ACTTTTGTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCCTTTTAACCTGATAAGAAGAA

TAGCTATTAAAATTTTGATACATTCAT - UNI21539 - TCTTCAGCATGATCATCATGTGCACCATCCTGACCAACTGTGTATTCATGACTTTTAGT

AACCCTCCCGAATGGTCCAAGAATGTGGA GTACACATTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGAC

GGCTTCACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGC - UNI30196 - ATATGTGACAGAGTTTGTGGACCTGGG

CAATGTCTCAGCGCTGAGAACATTCAGGGTTCTCCGAGCTTTGAAAACTATCTCTGTAATTCCAG GCCTGAAGACAATCGTGGGCGCCCTCATCCAGTC

TGTGAAGAAGCTGTCAGACGTGATGATCCTGACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG

TGTGTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGGAGTATATCAACAATAAAA CAAACTTTTAC

ATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAGCTCTGACGCCGG GCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCC

AACTACGGCTACACCAGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGAACTTATACCAGCTG ACC

TTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGTGGGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGG

CTTACGAAGAGCAGAACCAGGCAACACTGGAGGAGGCAGAGCAG AAAGGCCCTGGATCGCTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGA

AGGACAGAATCAACAGTATAATGAGCGTTGTCACAAACACACTAGTGGAAG AGCTGGAAGAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGTTTG

CCAATACTTTCCTCATCTGGGAGTGTCACCCCTACTGGATAAAACTGAAGGAGATTGTGAACCTGATCGTCATGGACCCTTTCGTAGACTTAGCCATAAC

CATCTGCATTGTCCTGAACACACTATTTATGGCAATGGAGCACCATCCCATGACGCCACAATTCGAACATGTCCTGGCCGTAGGGAACCTG GTGTTCAC

TGGGATCTTCACGGCGGAAATGTTCCTGAAGCTCATAGCCATGGATCCCTACTATTACTTCCAAGAAGGCTGGAACATTTTTGACGGATTTATCGTCTCC

CTCAGTTTAATGGAGCTGGGCCTTGCAGACGTGGAGGGGCTCTCAGTGCTGCGATCTTTCCGATTG CTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCC

ACCCTGAACATGCTGATCAAGATCATTGGGAACTCCGTTGGCGCCCTGGGCAACCTGACCCTGGTGCTGGCCATCATTGTCTTCATCTTTGCCGTGGTGG

GGATGCAGCTCTTTGGAAAGAGCTACAAGGAGTGCGTCTGTAAGATCAGCCAGGAGTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTT

CCTCATCGTCTTCCGAGTGCTGTGTGGGGAGTGGATCGAGACCATGTGGGATTGCATGGAAGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGATG

GTCATGGTCATCGGCAACCTGGTG GTGCTGAACTTATTTCTGGCCTTGCTTCTGAGCTCCTTCAGCGCAGACAATCTGGCGGCCACGGACGACGACGGG

GAAATGAACAACCTGCAGATATCGGTGATCCGGATCAAGAAGGGCGTGGCCTGGGCCAAAGTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAAC

GGGAGGCTGATGAAGTGAAACCTTTAGACGAGCTGTATGAGAAGAAGGCCAACTGCATCGCCAACCACACCGGCGTGGACATTCACAGGAACGGCGACTT

CCAGAAAAATGGAAATGGCACCACTAGCGGCATCGGCAGCAGCGTGGAGAAGTACATCATCGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTG

ACCGTGCGGGTGCCCATTGCTGTGGGCGAGTCTGATTTCGAGAACCTCAACACAGAGGATGTTAGCAGCGAGTCAGACCCCGAAGGCAGCAAAGAC AAA

CTGGACGATACCAGCTCCTCAGAAGGGAGTACCATCGACATCAAGCCTGAGGTGGAAGAAGTCCCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACG

CCTGCTTCACGGAGG GTTGTGTCCAGAGGTTCAAGTGCTGCCAGGTCAACATCGAGGAAGGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCT

TCCTCATTGTGGAGCACAATTGGTTTGAGACCTTCATCATTTTCATGATTCTCCTCAGCAGTGGAGCCCTG GCCTTCGAGGACATCTACATTGAGCAGA

GGAAGACCATCCGTACCATCCTGGAGTATGCGGACAAGGTCTTCACCTACATCTTCATCCTGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAA

GTTCTTCACCAATGCCTGGTGCTGGTTGGACTTCCTCATTGTGGCT GTCTCTTTAGTCAGCCTTATAGCTAATGCCCTGGGCTACTCGGAACTAGGTGC

CATAAAGTCCCTTAGGACCCTAAGAGCTTTGAGACCCTTAAGAGCCTTATCACGATTTGAAGGGATGAGG GTGGTGGTGAACGCCTTGGTGGGCGCCAT

CCCCTCCATCATGAACGTGCTGCTGGTGTGTCTCATCTTCTGGCTGATTTTCAGCATCATGGGCGTTAACCTGTTTGCTGGGAAATACCACTACTGCTTC

AACGAGACTTCAGAAATCCGGTTCGAAATCGACGAGGTGAACAATAAAACCGACTGTGAGAAGCTCATGGAGGGCAACAACACAGAGATCCGATGGAAGA

ACGTCAAGATCAACTTCGACAACGTCGGGGCAGGCTACCTGGCCCTTCTTCAAGTG GCAACCTTCAAAGGCTGGATGGACATCATGTATGCAGCTGTAG

ATTCCCGAAAG CCGGACGAGCAGCCTGATTATGAGGGCAACATCTACATGTACATCTACTTCGTCATCTTCATCATCTTCGGCTCCTTCTTCACCCTCA

ACCTGTTCATCGGTGTCATCATCGACAATTTCAATCAACAGAAGAAAAAG TTTGGAGGTCAGGACATCTTCATGACAGAGGAACAGAAGAAGTACTACA

ACGCCATGAAGAAGCTAGGCTCCAAGAAGCCACAGAAGCCCATCCCCCGACCTTTG AACAAAATCCAAGGGATTGTCTTTGATTTCGTCACGCAACAAG

CCTTCGACATCGTGATCATGATGCTTATCTGCCTTAACATGGTGACCATGATGGTGGAGACAGACACACAGAGCAAGCAGATGGAGAACATTCTCTACTG

GATTAATCTGGTCTTCGTCATCTTCTTCACCTGCGAGTGTGTGCTCAAAATGTTTGCCTTGAGACACTACTATTTCACCATTGGCTGGAACATCTTTGAC

TTTGTGGTGGTCATTCTCTCCATTGTGG GAATGTTCCTGGCTGATATCATTGAGAAGTACTTCGTCTCCCCGACCCTATTCCGCGTCATCCGATTGGCC

CGCATCGGGCGCATCTTGCGTCTGATCAAGGGCGCCAAAGGGATCCGCACCCTGCTCTTTGCCTTAATGATGTCGCTGCCCGCCCTGTTCAACATCGGCC

TCCTGCTCTTCCTGGTCATGTTCATCTTCTCCATCTTTGGGATGTCCAACTTCGCGTACGTGAAGCACGAGGCCGGCATTGATGACATGTTCAACTTCGA

GACGTTTGGCAACAGCATGATCTGCCTGTTCCAGATCACGACCTCTGCTGGTTGGGATGGCTTACTGCTGCCAATCCTGAACCGCCCCCCTGACTGCAGC

TTGGACAAGGAGCACCCAGGAAGTGGCTTCAAAGGGGACTGCGGGAACCCCTCCGTGGGCATCTTCTTCTTCGTCAGCTACATCATCATCTCCTTTCTGA

TCGTGGTAAACATGTACATTGCCATCATCTTGGAGAACTTCAGCGTAGCCACAGAGGAAAGCGCCGATCCTCTGAGCGAGGACGACTTCGAGACTTTCTA

TGAGATCTGGGAGAAGTTTGATCCTGATGCCACCCAGTTCATCGAGTACTGTAAGCTGGCCGACTTTGCCGACGCCCTGGAGCATCCGCTCCGAGTACCC

AAGCCCAACACCATCGAGCTCATCGCCATGGACCTGCCCATGGTGAGCGGAGATCGAATCCACTGCTTGGACATCCTTTTCGCCTTCACCAAGCGAGTCC

TGGGAGACAGTGGGGAGTTGGACATCCTGCGGCAGCAGATGGAGGAGCGGTTCGTGGCGTCCAATCCTTCCAAAGTGTCTTACGAGCCTATCACGACCAC

TCTGCGGCGCAAGCAGGAAGAGGTGTCTGCAGTGGTCTTGCAGCGTGCTTACAGGGGACACCTGGCTAGGCGGGGCTTCATCTGCAGAAAGATCACTTCC

AACAAGCTGGAGAATGGAGGCACCCACCGAGAGAAGAAGGAGAGCACCCCGTCCACAGCCTCCCTCCCCTCTTACGACAGCGTGACAAAGCCCGACAAGG

AGAAGCAGCAGCGGGCAGAGGAAGGCAGGAGGGAAAGAGCCAAGAGGCAAAAAGAAGTCAGGGAGTCCAAGTGCTAGAGGAGAGGGTAAGGGAAGCTTAC

GCTGGCTGAACACGGGCAAGTGAAAGCTTGTTTACAAACTTCCGAATCTCACGGACACAGAGCAGCTGCGGAGATGCTGTACTGGAAGACCTATACCAAA

CATAGTCTGCTTACACGTGACACGGTTGCATCCTGAGCGGTGACCTGCTGGGGACAAAGGACCCTGCTCCCTGGACTCACAGATTTTTTCTATCGCTTGG

GCAGACGTTACTGCATGTTCCACACTCGGTCAATGCAACTTAGGAGTAAACTTAACAGGATACAAACAGAGGCGGCTGCCAGGACCAGCAGATCGCCGCT

GCAGCCAAATGGATTCTATTTTTTTTTTCATTTTGTTGATTCTCAGAAGCAGAAAGCATCACTTTAAAAGTTTGTTTGTTCATGCAAACAATATTTGCAT

TCTTACATTAGTTAAGCTAAGCAGCAAAAAGAAACACACACACATACAGACACACAAAGACACACACAGACACATACACACACACACACACATTCAGCCT

ATGTCACTAATCGTCTGTTTCTTTAACATAACAGCATCTTCTCCACGTGGGTGGCACATGGTTTGGAGACGGTGGGGGAAACAATCAGGGTTTCAGGCTG

AGGAGGACTTGCTCAGGCCAATTCCAAATATTGTGCTCGTTCAATGCGTAGAAATGACTTGCATGATGGCATGCTGTGTTCAGAAGTCATGCATGAGGTC

CATACACCAACAGACACTAGCAATCCTGTCCCTCGCATTGGCTCAGCCTTCGGACAGGACCCAGCCCTGCACTGTTCACTGTATTTGGAGAAATGGTAAG

AGTTCCATACCGGCTGCAATCCTCTCAGTGTACAAGTCTTTCATACACCTCTGGGTAGGGAGACATAATTAACCAATTGACCACTACCAACAAAAACAAC

CCAACCAAACAAGCAGATGGATCCGCTGCATATACATGTTTGACAGACATCTCTGACATACAGCCATTGTCGTACATTTTGCTGCTCTGTCCAATACATG

GGGAGACTCTGGCCCCGAATGGCTTGTACTATTAATGTCACTGTAAAACCAAATCCTAGGGCTAAAAAAAAAAAAAAAAAGAAAAAAGAAAAAAAAAAGA

AAAATACTAATAGAAAAAAGAGTTCATTTGTATCTTGCAATATCCTGTTGATTGTTTAGCCTTCATCCTGGAGAACTGACCCTGGGGTAGAGATAAAAGT

GCTATGTATTGTAGCATGTTACCTCTAGGGGGCCTTTGGGGGGCTTACAGAAACCTTGTGGGGGGTTTGGGGTGCTTATTGCATTCAGTGTCATGTCTGT

CTGCTTTTCTCCAGGCTCAGGTAGATACGGAAAGGGGTTCAGATATTCTGAACTGCCCTGTCCTGCAGAGGGGTTGTCACAAGCTCCTGGCTGCACGGTT

CTTCCTGCTTCTGCCATATCCCTCCAGCCAGCAGGGCTCCCCTTCCCAGCCGCTCAGGGCTGGCAAGGACAGCAGTGTTGGCTGAGATAAGGCTGTAGGC

TCTTCCATTTGTAGAATAACGCTCTCTAACAGGACCTGATGGAAAGATGGAGCTGCCTCTGGACAGAGCCCACTTGGTCTTGTTTCTACGACGGCTTTTG

TGAGAAAGGGACTCAGTAGTCATTCTTTAGGGTGTCACAGCTTCCCCTGGCCTTTCCTTTCAGCTCACCTTGCTTTCTGCTTAGTGGCCTGCCCACTGTT

GTTGGGGGATGGCTTCTAGAGGGGCGTCATATCTTCCATTCCATCCCCCACTTTATAGAAGACAGTTCTTAGTCCAGGGTGTCTCAGCTGACCACAAGGT

CTCAAAGCCAAGATGCTGCACTCGAATGCCAGAAAGTCTCTCTGAACCAAATCAACACAAACTCTCCCTGAGCATAGTATGGAGGGAATCGAGTGGCCCA

TCAGTAGACACATCAGATGCACCAGTCCGCCTTGCAGTAGAAGCACTTTGGATGTAATCTCACAGTCCACCTGACTAGTTTTGCATAGAACAAACCACAG

CCAGTCAGTGAGCAGAGCTTTCTATCTTCTTGGACCGGTAGACACTGTCCAACTCTCCCAGCTCAGAGAGTGTGTCCGTGTCACCACAGCTAGGACAATT

CTAGAGCGCCACCTGCAGGCAACATCGCAAACAGCACAAAACAGGAGCTGACCTGTGGTTATTCTTTTTAAGAGAATTATAAATACTGTAATATATAATT

TTATTTTATTGGCATGCCTTTTTGTAAATACAAATTACTAACTTATTAAATAGGAAATGGCTTCTGGCTTACGCCATTGTCATGGTTATTTTTATTTTTT

ATACTTTCCTTTCTTCTTAGAATTTAGAAGCTGTCAGCCAATGTATACCCCTAACCAGACAGACAGACAAAAAATTTTTTATTGCTAATGGTATTTTCCA

AAACAACAAAATATATATATATTTTTGTTCCAATGTGCAATAAATTCTAACCACTTCTATGCAAGATTTGGCTAAACTCAATCATTGTTCTTAGATCTTG

AGATGGGCAACAGCTATTTGATCCTGCTAGGAACACCAAGCGCCATGCTAGTAATGTTCAGCGATTAGATCTGACCCTCCTACCCCAGCTCCTGACCCAG

CCCAGCAGGCTGTGCCTCAGTTTCTCACACCCTCCAACAGCCTCGCAGGGAAGAAGCCACCTCCGAGTCTGCTTGCTCTAACTTTCACTCTGATCAGACC

TCTCCCAGCAATGCCCCTCACCTTCCATCTGTCCACCCAGCCACTCTCTGCCCGCCTCGCTCTCTCTGTCCCACTCCATGATCCTTTCTTGTGAACCACA

CCATCACCAGCAGTTCACACCCGCAGTTAACAGGCATCGAACCTTAAAGAATCAGCTACGGCAGGTTTTGGTTGGTTTGGTTTTGTTTTGCGTCCTCATT

GCGTGAGCAAGTGGCAGGGCTTTGCCAAATATTCATGAAGCCTGTCAAAGAGCGGCAGCAGCCAGTACCACTGCACATATATATATAGATATATAAATAT

AATATAAATATTTATTTTTTGTAGCCGGGTCCTTGGTGCAGTATTTATATTCCACGATCCTCCTTTAAAAATAATAATAATAATAATAAAAAGGACAAAA

AAGCAAAAAGTCATGTGATGCTGTTCATTTAAAACGCAGAGCCAAAGCCCCTGAGCAGTAGTCGCCATGACTACTGGTTGTGTGAAAACACTCCCTTCTT

CCTTAACTTCCCTGTGGCTTAGGGTGAGAGGCTGGGAGTCACAGGGCAGAGGGTGGGAGCAGGAAAGCCGAGTCTGAGTGATCTGCTCTCACCATCTGGA

AATGAGCCACTTGGGCATCTGAAGCTGCGCACAGAGAGACAAGCTCCCCCTCAGGGCCCCTGAAGCGACATAGAGTGCCCAAAGGGCTTCTCTCATCACC

ACAACCCACGTAAACTGTAAGAGACCCATAGTGTGCTAGTGAGTGCATGGAGCCTGATGCTGCCCTAAACGATACCTGATCTTTAGAAAAGTAAATCACT

ATTAGCCAAAAGGAAACAAAATTTACAAAACAAACAAACAAACAAAAAATACGGCCCTTTTTAACCACACAAGGGAAGCCCGTCTTGCTGTGTGTCTGTT

TGACTTTCCAGTTATTGAGGTCTGGGAACTGGGACCCTGGAGCTTTGGGGAAGGAGAAAGGAAAACAGAGCCCCCCCCCCCCAATTCTAAGTAGGTACTG

CAGAGAAAAGCCAGGTCCTGACCCCCCAGGTCCCTGCTTACTGATTGCATGTGGCATTACCCCTTAGACTGGACCCCCCTCCCTCACCGTTTCCACCCAG

CAGAGCCCCCCAGAGATGACTTCAACCAACCTAGCTGGTCTGGCCTTACTTCTGCCTTGTTCATGGTTATGATTTAAGAAAGAAAGAAAAAAAAAAAACC

TCTCCTGACCCCCCACCTCCCAAGGCTAGCGCAAGCACGCTGCCCGGCAGCTTCCAGTCCACCAGCTCGTGCTGGCCCTGCCTTCCATCCACTCCCATTA

TCAGACCGGCAGACTGGGGCTGTCCCCTTCACATTTGTGCAGGGGAGGGGGCATCCCTTGGGGACATCCCTCTCCAGGCCATGTCTCCTGGTCTAGGAAC

ACTCAGGAGGATCTTGAAGTGCCCACTCTAGTCCACTCTAGTAGCTGAACTAGAGAGAGTCGGCTGGTAGGTCAGTCCCTGTCCTTGTCCCTCAGCTCCA

GCCTCCAGGCCTTCTGTGGAGGTGAAATTGCCATGGGTCCGGACATGGTGACCTGAACCCTGGGCATCTTCTGGAACGATGCCTCTTTCTTTTCTCAGAT

GTTGCCCAAAGTTTTGCAAAAAGCTTCCTTCATTTTCAGGTACTCCCCCGCCCCCTAAAGAATTAGCTGCCGTCAGTCAGCCAGGGGGGTCAGGAGAAGA

GGAAGTCTGGGTTCAGAGGACAAGACTTGCACCCCGGCCTGTGCTTCTTGCCTCTTCTCAAGACTGCCAAGATTTCCTCCATTAAAACACTCCTGAGGCA

CCCCTGCCCCTGACCCCACTGCTGTTTGCTGTACATAGAGGCTAAGTGGGGTGAAGTGGGCAGGTGTGCACATGTATGTGTGTGTGTGTGTGAAGAATGT

ACATAGGTAAAGGGGAGCGTGGTCCAGTGGTTCCAGAAGAGGGACAGAACTGTGTTCCATCCCTAGCTTGACCACTGGCTCGCTGTGTGGCCTTGGGCAA

GTCACTTAACCTCTCTGTGCCTCAGTTTCCCCATCTGTAAAATGGGGGTAATAATACTGACCTACCTCACAGGGGTGTTGTGAGGCTTTAACTAGATGTT

TTGTAAAGCGTTCTGAGATACAGAGACAAAGGCGCCAGGGAAGGGCAAAGTATTCTTTGGACTTGAGGAAGAGGAACTAGTACCATAAACGCTGCTATTC

TGAGAGCCATTTTAAACTGCACTGCTCCACCACCCCCCGCTTCTCATCACCAGGACAGCAGGTCGAGAAATGTCTTTCCTTGCACTTGCTTCTGGGGTTT

GTGATTCTTCTGATTTTTCCCTTTGCTGTATCTCCTTCCTTACCCCTCCACTCGTTCCCTGTTCTGTTAATGCGGAAATGGCAGAAATGCTTGAGAAATG

AGAATGTATAAGTGGATTGGAAGTTTATAGTCTGGATTTTCAATTTTACTTTGTACTGTACATCTTTTTACTTTAGAATTTGCAATAAAGGGTTACGTCA

ATCTTGTTTTCAACTCTC
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSF - UNI21539 - FFSMIIMCTILTNCVFMTFSNPPEWSKNVE EYTFTGI

YTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMA - UNI30196 - AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKL

SDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKT TNFYMVPGMLEPLLCGNSSDAG GQCPEGFQCMKAGRNPN

YGYTSFDTFSWAFLALFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQ KGPGSLLVSMEQLASYGR

KDRINSIMSVVTNTLVEE ELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNL 

VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSVLRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIF

AVVGMQLFGKSYKECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLV VLNLFLALLLSSFSADNLAAT

DDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFIN

NPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKD KLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEG GCVQRFKCCQVNIEEGLGKSWW

ILRKTCFLIVEHNWFETFIIFMILLSSGAL AFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVA VSLVSLIANA

LGYSELGAIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDCEKLMEG

NNTEIRWKNVKINFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRK PDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK FGGQDI

FMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRH

YYFTIGWNIFDFVVVILSIVG GMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV

KHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEES

ADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVAS

NPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICRKITSNKLENGGTHREKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRRERAKRQKEVR

ESKC
Transcript ENSMUST00000108909
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA ACTTTTGTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCCTTTTAACCTGATAAGAAGAA

TAGCTATTAAAATTTTGATACATTCAT - UNI21539 - TCTTCAGCATGATCATCATGTGCACCATCCTGACCAACTGTGTATTCATGACTTTTAGT

AACCCTCCCGAATGGTCCAAGAATGTGGA GTACACATTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGAC

GGCTTCACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGC - UNI30196 - ATATGTGACAGAGTTTGTGGACCTGGG

CAATGTCTCAGCGCTGAGAACATTCAGGGTTCTCCGAGCTTTGAAAACTATCTCTGTAATTCCAG GCCTGAAGACAATCGTGGGCGCCCTCATCCAGTC

TGTGAAGAAGCTGTCAGACGTGATGATCCTGACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG

TGTGTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGGAGTATATCAACAATAAAA CAAACTTTTAC

ATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAGCTCTGACGCCGG GCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCC

AACTACGGCTACACCAGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGAACTTATACCAGCTG ACC

TTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGTGGGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGG

CTTACGAAGAGCAGAACCAGGCAACACTGGAGGAGGCAGAGCAGAAAGAGGCAGAGTTCAAGGCGATGCTGGAGCAGCTCAAGAAGCAGCAGGAGGAGGC

GCAG GCTGCTGCAATGGCCACTTCGGCGGGCACCGTCTCAGAAGATGCCATTGAAGAAGAAGGGGAAGATGGGGTAGGCTCTCCGAGGAGCTCATCTGA

GCTGTCTAAACTCAGTTCCAAGAGCGCGAAGGAGCGTCGGAACCGACGGAAGAAGAGGAAGCAGAAGGAGCTCTCTGAAGGGGAGGAGAAGGGGGACCCC

GAGAAGGTGTTTAAGTCAGAGTCGGAAGATGGCATGAGAAGGAAGGCCTTCCGGCTGCCAGACAATAGGATAGGGAGGAAATTTTCCATCATGAATCAG 

TCGCTGCTCAGCATCCCAGGCTCGCCCTTCCTTTCCCGACACAACAGCAAAAGCAGCATCTTCAGCTTTCGGGGTCCTGGACGGTTCCGGGACCCCGGTT

CGGAGAACGAGTTCGCAGACGACGAGCACAGCACAGTGGAGGAAAGTGAGGGCCGGCGCGACTCGCTCTTCATCCCGATCCGCGCCCGCGAGCGCCGCAG

CAGCTACAGCGGCTACAGCGGCTACAGCCAGTGCAGCCGCTCGTCGCGCATCTTCCCCAGCCTGCGGCGCAGCGTGAAACGCAACAGCACCGTGGACTGC

AATGGCGTGGTGTCGCTCATCGGGCCTGGCTCGCACATCGGGCGGCTCCTGCCTGAG GCAACAACTGAGGTGGAGATTAAGAAGAAAGGCCCTGGATCG

CTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGAAGGACAGAATCAACAGTATAATGAGCGTTGTCACAAACACACTAGTGGAAG AGCTGGAA

GAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGTTTGCCAATACTTTCCTCATCTGGGAGTGTCACCCCTACTGGATAAAACTGAAGGAGATTGTGA

ACCTGATCGTCATGGACCCTTTCGTAGACTTAGCCATAACCATCTGCATTGTCCTGAACACACTATTTATGGCAATGGAGCACCATCCCATGACGCCACA

ATTCGAACATGTCCTGGCCGTAGGGAACCTG GTGTTCACTGGGATCTTCACGGCGGAAATGTTCCTGAAGCTCATAGCCATGGATCCCTACTATTACTT

CCAAGAAGGCTGGAACATTTTTGACGGATTTATCGTCTCCCTCAGTTTAATGGAGCTGGGCCTTGCAGACGTGGAGGGGCTCTCAGTGCTGCGATCTTTC

CGATTG CTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCCACCCTGAACATGCTGATCAAGATCATTGGGAACTCCGTTGGCGCCCTGGGCAACCTGACC

CTGGTGCTGGCCATCATTGTCTTCATCTTTGCCGTGGTGGGGATGCAGCTCTTTGGAAAGAGCTACAAGGAGTGCGTCTGTAAGATCAGCCAGGAGTGCA

AGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTCATCGTCTTCCGAGTGCTGTGTGGGGAGTGGATCGAGACCATGTGGGATTGCATGGA

AGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGATGGTCATGGTCATCGGCAACCTGGTG GTGCTGAACTTATTTCTGGCCTTGCTTCTGAGCTC

CTTCAGCGCAGACAATCTGGCGGCCACGGACGACGACGGGGAAATGAACAACCTGCAGATATCGGTGATCCGGATCAAGAAGGGCGTGGCCTGGGCCAAA

GTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAACGGGAGGCTGATGAAGTGAAACCTTTAGACGAGCTGTATGAGAAGAAGGCCAACTGCATCG

CCAACCACACCGGCGTGGACATTCACAGGAACGGCGACTTCCAGAAAAATGGAAATGGCACCACTAGCGGCATCGGCAGCAGCGTGGAGAAGTACATCAT

CGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTGACCGTGCGGGTGCCCATTGCTGTGGGCGAGTCTGATTTCGAGAACCTCAACACAGAGGAT

GTTAGCAGCGAGTCAGACCCCGAAGGCAGCAAAGAC AAACTGGACGATACCAGCTCCTCAGAAGGGAGTACCATCGACATCAAGCCTGAGGTGGAAGAA

GTCCCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACGCCTGCTTCACGGAGG GTTGTGTCCAGAGGTTCAAGTGCTGCCAGGTCAACATCGAGGAA

GGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCTTCCTCATTGTGGAGCACAATTGGTTTGAGACCTTCATCATTTTCATGATTCTCCTCAGCA

GTGGAGCCCTG GCCTTCGAGGACATCTACATTGAGCAGAGGAAGACCATCCGTACCATCCTGGAGTATGCGGACAAGGTCTTCACCTACATCTTCATCC

TGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAAGTTCTTCACCAATGCCTGGTGCTGGTTGGACTTCCTCATTGTGGCT GTGGTGGTGAACG

CCTTGGTGGGCGCCATCCCCTCCATCATGAACGTGCTGCTGGTGTGTCTCATCTTCTGGCTGATTTTCAGCATCATGGGCGTTAACCTGTTTGCTGGGAA

ATACCACTACTGCTTCAACGAGACTTCAGAAATCCGGTTCGAAATCGACGAGGTGAACAATAAAACCGACTGTGAGAAGCTCATGGAGGGCAACAACACA

GAGATCCGATGGAAGAACGTCAAGATCAACTTCGACAACGTCGGGGCAGGCTACCTGGCCCTTCTTCAAGTG GCAACCTTCAAAGGCTGGATGGACATC

ATGTATGCAGCTGTAGATTCCCGAAAG CCGGACGAGCAGCCTGATTATGAGGGCAACATCTACATGTACATCTACTTCGTCATCTTCATCATCTTCGGC

TCCTTCTTCACCCTCAACCTGTTCATCGGTGTCATCATCGACAATTTCAATCAACAGAAGAAAAAG TTTGGAGGTCAGGACATCTTCATGACAGAGGAA

CAGAAGAAGTACTACAACGCCATGAAGAAGCTAGGCTCCAAGAAGCCACAGAAGCCCATCCCCCGACCTTTG AACAAAATCCAAGGGATTGTCTTTGAT

TTCGTCACGCAACAAGCCTTCGACATCGTGATCATGATGCTTATCTGCCTTAACATGGTGACCATGATGGTGGAGACAGACACACAGAGCAAGCAGATGG

AGAACATTCTCTACTGGATTAATCTGGTCTTCGTCATCTTCTTCACCTGCGAGTGTGTGCTCAAAATGTTTGCCTTGAGACACTACTATTTCACCATTGG

CTGGAACATCTTTGACTTTGTGGTGGTCATTCTCTCCATTGTGG GAATGTTCCTGGCTGATATCATTGAGAAGTACTTCGTCTCCCCGACCCTATTCCG

CGTCATCCGATTGGCCCGCATCGGGCGCATCTTGCGTCTGATCAAGGGCGCCAAAGGGATCCGCACCCTGCTCTTTGCCTTAATGATGTCGCTGCCCGCC

CTGTTCAACATCGGCCTCCTGCTCTTCCTGGTCATGTTCATCTTCTCCATCTTTGGGATGTCCAACTTCGCGTACGTGAAGCACGAGGCCGGCATTGATG

ACATGTTCAACTTCGAGACGTTTGGCAACAGCATGATCTGCCTGTTCCAGATCACGACCTCTGCTGGTTGGGATGGCTTACTGCTGCCAATCCTGAACCG

CCCCCCTGACTGCAGCTTGGACAAGGAGCACCCAGGAAGTGGCTTCAAAGGGGACTGCGGGAACCCCTCCGTGGGCATCTTCTTCTTCGTCAGCTACATC

ATCATCTCCTTTCTGATCGTGGTAAACATGTACATTGCCATCATCTTGGAGAACTTCAGCGTAGCCACAGAGGAAAGCGCCGATCCTCTGAGCGAGGACG

ACTTCGAGACTTTCTATGAGATCTGGGAGAAGTTTGATCCTGATGCCACCCAGTTCATCGAGTACTGTAAGCTGGCCGACTTTGCCGACGCCCTGGAGCA

TCCGCTCCGAGTACCCAAGCCCAACACCATCGAGCTCATCGCCATGGACCTGCCCATGGTGAGCGGAGATCGAATCCACTGCTTGGACATCCTTTTCGCC

TTCACCAAGCGAGTCCTGGGAGACAGTGGGGAGTTGGACATCCTGCGGCAGCAGATGGAGGAGCGGTTCGTGGCGTCCAATCCTTCCAAAGTGTCTTACG

AGCCTATCACGACCACTCTGCGGCGCAAGCAGGAAGAGGTGTCTGCAGTGGTCTTGCAGCGTGCTTACAGGGGACACCTGGCTAGGCGGGGCTTCATCTG

CAGAAAGATCACTTCCAACAAGCTGGAGAATGGAGGCACCCACCGAGAGAAGAAGGAGAGCACCCCGTCCACAGCCTCCCTCCCCTCTTACGACAGCGTG

ACAAAGCCCGACAAGGAGAAGCAGCAGCGGGCAGAGGAAGGCAGGAGGGAAAGAGCCAAGAGGCAAAAAGAAGTCAGGGAGTCCAAGTGCTAGAGGAGAG

GGTAAGGGAAGCTTACGCTGGCTGAACACGGGCAAGTGAAAGCTTGTTTACAAACTTCCGAATCTCACGGACACAGAGCAGCTGCGGAGATGCTGTACTG

GAAGACCTATACCAAACATAGTCTGCTTACACGTGACACGGTTGCATCCTGAGCGGTGACCTGCTGGGGACAAAGGACCCTGCTCCCTGGACTCACAGAT

TTTTTCTATCGCTTGGGCAGACGTTACTGCATGTTCCACACTCGGTCAATGCAACTTAGGAGTAAACTTAACAGGATACAAACAGAGGCGGCTGCCAGGA

CCAGCAGATCGCCGCTGCAGCCAAATGGATTCTATTTTTTTTTTCATTTTGTTGATTCTCAGAAGCAGAAAGCATCACTTTAAAAGTTTGTTTGTTCATG

CAAACAATATTTGCATTCTTACATTAGTTAAGCTAAGCAGCAAAAAGAAACACACACACATACAGACACACAAAGACACACACAGACACATACACACACA

CACACACATTCAGCCTATGTCACTAATCGTCTGTTTCTTTAACATAACAGCATCTTCTCCACGTGGGTGGCACATGGTTTGGAGACGGTGGGGGAAACAA

TCAGGGTTTCAGGCTGAGGAGGACTTGCTCAGGCCAATTCCAAATATTGTGCTCGTTCAATGCGTAGAAATGACTTGCATGATGGCATGCTGTGTTCAGA

AGTCATGCATGAGGTCCATACACCAACAGACACTAGCAATCCTGTCCCTCGCATTGGCTCAGCCTTCGGACAGGACCCAGCCCTGCACTGTTCACTGTAT

TTGGAGAAATGGTAAGAGTTCCATACCGGCTGCAATCCTCTCAGTGTACAAGTCTTTCATACACCTCTGGGTAGGGAGACATAATTAACCAATTGACCAC

TACCAACAAAAACAACCCAACCAAACAAGCAGATGGATCCGCTGCATATACATGTTTGACAGACATCTCTGACATACAGCCATTGTCGTACATTTTGCTG

CTCTGTCCAATACATGGGGAGACTCTGGCCCCGAATGGCTTGTACTATTAATGTCACTGTAAAACCAAATCCTAGGGCTAAAAAAAAAAAAAAAAAGAAA

AAAGAAAAAAAAAAGAAAAATACTAATAGAAAAAAGAGTTCATTTGTATCTTGCAATATCCTGTTGATTGTTTAGCCTTCATCCTGGAGAACTGACCCTG

GGGTAGAGATAAAAGTGCTATGTATTGTAGCATGTTACCTCTAGGGGGCCTTTGGGGGGCTTACAGAAACCTTGTGGGGGGTTTGGGGTGCTTATTGCAT

TCAGTGTCATGTCTGTCTGCTTTTCTCCAGGCTCAGGTAGATACGGAAAGGGGTTCAGATATTCTGAACTGCCCTGTCCTGCAGAGGGGTTGTCACAAGC

TCCTGGCTGCACGGTTCTTCCTGCTTCTGCCATATCCCTCCAGCCAGCAGGGCTCCCCTTCCCAGCCGCTCAGGGCTGGCAAGGACAGCAGTGTTGGCTG

AGATAAGGCTGTAGGCTCTTCCATTTGTAGAATAACGCTCTCTAACAGGACCTGATGGAAAGATGGAGCTGCCTCTGGACAGAGCCCACTTGGTCTTGTT

TCTACGACGGCTTTTGTGAGAAAGGGACTCAGTAGTCATTCTTTAGGGTGTCACAGCTTCCCCTGGCCTTTCCTTTCAGCTCACCTTGCTTTCTGCTTAG

TGGCCTGCCCACTGTTGTTGGGGGATGGCTTCTAGAGGGGCGTCATATCTTCCATTCCATCCCCCACTTTATAGAAGACAGTTCTTAGTCCAGGGTGTCT

CAGCTGACCACAAGGTCTCAAAGCCAAGATGCTGCACTCGAATGCCAGAAAGTCTCTCTGAACCAAATCAACACAAACTCTCCCTGAGCATAGTATGGAG

GGAATCGAGTGGCCCATCAGTAGACACATCAGATGCACCAGTCCGCCTTGCAGTAGAAGCACTTTGGATGTAATCTCACAGTCCACCTGACTAGTTTTGC

ATAGAACAAACCACAGCCAGTCAGTGAGCAGAGCTTTCTATCTTCTTGGACCGGTAGACACTGTCCAACTCTCCCAGCTCAGAGAGTGTGTCCGTGTCAC

CACAGCTAGGACAATTCTAGAGCGCCACCTGCAGGCAACATCGCAAACAGCACAAAACAGGAGCTGACCTGTGGTTATTCTTTTTAAGAGAATTATAAAT

ACTGTAATATATAATTTTATTTTATTGGCATGCCTTTTTGTAAATACAAATTACTAACTTATTAAATAGGAAATGGCTTCTGGCTTACGCCATTGTCATG

GTTATTTTTATTTTTTATACTTTCCTTTCTTCTTAGAATTTAGAAGCTGTCAGCCAATGTATACCCCTAACCAGACAGACAGACAAAAAATTTTTTATTG

CTAATGGTATTTTCCAAAACAACAAAATATATATATATTTTTGTTCCAATGTGCAATAAATTCTAACCACTTCTATGCAAGATTTGGCTAAACTCAATCA

TTGTTCTTAGATCTTGAGATGGGCAACAGCTATTTGATCCTGCTAGGAACACCAAGCGCCATGCTAGTAATGTTCAGCGATTAGATCTGACCCTCCTACC

CCAGCTCCTGACCCAGCCCAGCAGGCTGTGCCTCAGTTTCTCACACCCTCCAACAGCCTCGCAGGGAAGAAGCCACCTCCGAGTCTGCTTGCTCTAACTT

TCACTCTGATCAGACCTCTCCCAGCAATGCCCCTCACCTTCCATCTGTCCACCCAGCCACTCTCTGCCCGCCTCGCTCTCTCTGTCCCACTCCATGATCC

TTTCTTGTGAACCACACCATCACCAGCAGTTCACACCCGCAGTTAACAGGCATCGAACCTTAAAGAATCAGCTACGGCAGGTTTTGGTTGGTTTGGTTTT

GTTTTGCGTCCTCATTGCGTGAGCAAGTGGCAGGGCTTTGCCAAATATTCATGAAGCCTGTCAAAGAGCGGCAGCAGCCAGTACCACTGCACATATATAT

ATAGATATATAAATATAATATAAATATTTATTTTTTGTAGCCGGGTCCTTGGTGCAGTATTTATATTCCACGATCCTCCTTTAAAAATAATAATAATAAT

AATAAAAAGGACAAAAAAGCAAAAAGTCATGTGATGCTGTTCATTTAAAACGCAGAGCCAAAGCCCCTGAGCAGTAGTCGCCATGACTACTGGTTGTGTG

AAAACACTCCCTTCTTCCTTAACTTCCCTGTGGCTTAGGGTGAGAGGCTGGGAGTCACAGGGCAGAGGGTGGGAGCAGGAAAGCCGAGTCTGAGTGATCT

GCTCTCACCATCTGGAAATGAGCCACTTGGGCATCTGAAGCTGCGCACAGAGAGACAAGCTCCCCCTCAGGGCCCCTGAAGCGACATAGAGTGCCCAAAG

GGCTTCTCTCATCACCACAACCCACGTAAACTGTAAGAGACCCATAGTGTGCTAGTGAGTGCATGGAGCCTGATGCTGCCCTAAACGATACCTGATCTTT

AGAAAAGTAAATCACTATTAGCCAAAAGGAAACAAAATTTACAAAACAAACAAACAAACAAAAAATACGGCCCTTTTTAACCACACAAGGGAAGCCCGTC

TTGCTGTGTGTCTGTTTGACTTTCCAGTTATTGAGGTCTGGGAACTGGGACCCTGGAGCTTTGGGGAAGGAGAAAGGAAAACAGAGCCCCCCCCCCCCAA

TTCTAAGTAGGTACTGCAGAGAAAAGCCAGGTCCTGACCCCCCAGGTCCCTGCTTACTGATTGCATGTGGCATTACCCCTTAGACTGGACCCCCCTCCCT

CACCGTTTCCACCCAGCAGAGCCCCCCAGAGATGACTTCAACCAACCTAGCTGGTCTGGCCTTACTTCTGCCTTGTTCATGGTTATGATTTAAGAAAGAA

AGAAAAAAAAAAAACCTCTCCTGACCCCCCACCTCCCAAGGCTAGCGCAAGCACGCTGCCCGGCAGCTTCCAGTCCACCAGCTCGTGCTGGCCCTGCCTT

CCATCCACTCCCATTATCAGACCGGCAGACTGGGGCTGTCCCCTTCACATTTGTGCAGGGGAGGGGGCATCCCTTGGGGACATCCCTCTCCAGGCCATGT

CTCCTGGTCTAGGAACACTCAGGAGGATCTTGAAGTGCCCACTCTAGTCCACTCTAGTAGCTGAACTAGAGAGAGTCGGCTGGTAGGTCAGTCCCTGTCC

TTGTCCCTCAGCTCCAGCCTCCAGGCCTTCTGTGGAGGTGAAATTGCCATGGGTCCGGACATGGTGACCTGAACCCTGGGCATCTTCTGGAACGATGCCT

CTTTCTTTTCTCAGATGTTGCCCAAAGTTTTGCAAAAAGCTTCCTTCATTTTCAGGTACTCCCCCGCCCCCTAAAGAATTAGCTGCCGTCAGTCAGCCAG

GGGGGTCAGGAGAAGAGGAAGTCTGGGTTCAGAGGACAAGACTTGCACCCCGGCCTGTGCTTCTTGCCTCTTCTCAAGACTGCCAAGATTTCCTCCATTA

AAACACTCCTGAGGCACCCCTGCCCCTGACCCCACTGCTGTTTGCTGTACATAGAGGCTAAGTGGGGTGAAGTGGGCAGGTGTGCACATGTATGTGTGTG

TGTGTGTGAAGAATGTACATAGGTAAAGGGGAGCGTGGTCCAGTGGTTCCAGAAGAGGGACAGAACTGTGTTCCATCCCTAGCTTGACCACTGGCTCGCT

GTGTGGCCTTGGGCAAGTCACTTAACCTCTCTGTGCCTCAGTTTCCCCATCTGTAAAATGGGGGTAATAATACTGACCTACCTCACAGGGGTGTTGTGAG

GCTTTAACTAGATGTTTTGTAAAGCGTTCTGAGATACAGAGACAAAGGCGCCAGGGAAGGGCAAAGTATTCTTTGGACTTGAGGAAGAGGAACTAGTACC

ATAAACGCTGCTATTCTGAGAGCCATTTTAAACTGCACTGCTCCACCACCCCCCGCTTCTCATCACCAGGACAGCAGGTCGAGAAATGTCTTTCCTTGCA

CTTGCTTCTGGGGTTTGTGATTCTTCTGATTTTTCCCTTTGCTGTATCTCCTTCCTTACCCCTCCACTCGTTCCCTGTTCTGTTAATGCGGAAATGGCAG

AAATGCTTGAGAAATGAGAATGTATAAGTGGATTGGAAGTTTATAGTCTGGATTTTCAATTTTACTTTGTACTGTACATCTTTTTACTTTAGAATTTGCA

ATAAAGGGTTACGTCAATCTTGTTTTCAACTCTC
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSF - UNI21539 - FFSMIIMCTILTNCVFMTFSNPPEWSKNVE EYTFTGI

YTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMA - UNI30196 - AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKL

SDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKT TNFYMVPGMLEPLLCGNSSDAG GQCPEGFQCMKAGRNPN

YGYTSFDTFSWAFLALFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEA

Q AAAMATSAGTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQ

 SLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVD

CNGVVSLIGPGSHIGRLLPE ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMSVVTNTLVEE ELEESQRKCPPCWYKFANTFLIWECHPYWIKLK

EIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNL VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSV

LRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETM

WDCMEVAGQAMCLIVFMMVMVIGNLV VLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEK

KANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKD KLDDTSSSEGSTIDI

KPEVEEVPVEQPEEYLDPDACFTEG GCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGAL AFEDIYIEQRKTIRTILEYAD

KVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVA VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDC

EKLMEGNNTEIRWKNVKINFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRK PDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK 

FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLK

MFALRHYYFTIGWNIFDFVVVILSIVG GMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGM

SNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFS

VATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQME

ERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICRKITSNKLENGGTHREKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRRERAK

RQKEVRESKC
Transcript ENSMUST00000108910
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA ACTTTTGTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCCTTTTAACCTGATAAGAAGAA

TAGCTATTAAAATTTTGATACATTCAT - UNI21539 - TCTTCAGCATGATCATCATGTGCACCATCCTGACCAACTGTGTATTCATGACTTTTAGT

AACCCTCCCGAATGGTCCAAGAATGTGGA GTACACATTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGAC

GGCTTCACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGC - UNI30196 - GTATATAACAGAGTTTGTAAACCTAGG

CAATGTTTCAGCTCTACGCACTTTCAGGGTACTGAGGGCTTTGAAAACTATTTCGGTAATCCCAG GCCTGAAGACAATCGTGGGCGCCCTCATCCAGTC

TGTGAAGAAGCTGTCAGACGTGATGATCCTGACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG

TGTGTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGGAGTATATCAACAATAAAA CAAACTTTTAC

ATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAGCTCTGACGCCGG GCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCC

AACTACGGCTACACCAGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGAACTTATACCAGCTG ACC

TTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGTGGGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGG

CTTACGAAGAGCAGAACCAGGCAACACTGGAGGAGGCAGAGCAGAAAGAGGCAGAGTTCAAGGCGATGCTGGAGCAGCTCAAGAAGCAGCAGGAGGAGGC

GCAG GCTGCTGCAATGGCCACTTCGGCGGGCACCGTCTCAGAAGATGCCATTGAAGAAGAAGGGGAAGATGGGGTAGGCTCTCCGAGGAGCTCATCTGA

GCTGTCTAAACTCAGTTCCAAGAGCGCGAAGGAGCGTCGGAACCGACGGAAGAAGAGGAAGCAGAAGGAGCTCTCTGAAGGGGAGGAGAAGGGGGACCCC

GAGAAGGTGTTTAAGTCAGAGTCGGAAGATGGCATGAGAAGGAAGGCCTTCCGGCTGCCAGACAATAGGATAGGGAGGAAATTTTCCATCATGAATCAG 

TCGCTGCTCAGCATCCCAGGCTCGCCCTTCCTTTCCCGACACAACAGCAAAAGCAGCATCTTCAGCTTTCGGGGTCCTGGACGGTTCCGGGACCCCGGTT

CGGAGAACGAGTTCGCAGACGACGAGCACAGCACAGTGGAGGAAAGTGAGGGCCGGCGCGACTCGCTCTTCATCCCGATCCGCGCCCGCGAGCGCCGCAG

CAGCTACAGCGGCTACAGCGGCTACAGCCAGTGCAGCCGCTCGTCGCGCATCTTCCCCAGCCTGCGGCGCAGCGTGAAACGCAACAGCACCGTGGACTGC

AATGGCGTGGTGTCGCTCATCGGGCCTGGCTCGCACATCGGGCGGCTCCTGCCTGAG GCAACAACTGAGGTGGAGATTAAGAAGAAAGGCCCTGGATCG

CTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGAAGGACAGAATCAACAGTATAATGAGCGTTGTCACAAACACACTAGTGGAAG AGCTGGAA

GAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGTTTGCCAATACTTTCCTCATCTGGGAGTGTCACCCCTACTGGATAAAACTGAAGGAGATTGTGA

ACCTGATCGTCATGGACCCTTTCGTAGACTTAGCCATAACCATCTGCATTGTCCTGAACACACTATTTATGGCAATGGAGCACCATCCCATGACGCCACA

ATTCGAACATGTCCTGGCCGTAGGGAACCTG GTGTTCACTGGGATCTTCACGGCGGAAATGTTCCTGAAGCTCATAGCCATGGATCCCTACTATTACTT

CCAAGAAGGCTGGAACATTTTTGACGGATTTATCGTCTCCCTCAGTTTAATGGAGCTGGGCCTTGCAGACGTGGAGGGGCTCTCAGTGCTGCGATCTTTC

CGATTG CTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCCACCCTGAACATGCTGATCAAGATCATTGGGAACTCCGTTGGCGCCCTGGGCAACCTGACC

CTGGTGCTGGCCATCATTGTCTTCATCTTTGCCGTGGTGGGGATGCAGCTCTTTGGAAAGAGCTACAAGGAGTGCGTCTGTAAGATCAGCCAGGAGTGCA

AGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTCATCGTCTTCCGAGTGCTGTGTGGGGAGTGGATCGAGACCATGTGGGATTGCATGGA

AGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGATGGTCATGGTCATCGGCAACCTGGTG GTGCTGAACTTATTTCTGGCCTTGCTTCTGAGCTC

CTTCAGCGCAGACAATCTGGCGGCCACGGACGACGACGGGGAAATGAACAACCTGCAGATATCGGTGATCCGGATCAAGAAGGGCGTGGCCTGGGCCAAA

GTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAACGGGAGGCTGATGAAGTGAAACCTTTAGACGAGCTGTATGAGAAGAAGGCCAACTGCATCG

CCAACCACACCGGCGTGGACATTCACAGGAACGGCGACTTCCAGAAAAATGGAAATGGCACCACTAGCGGCATCGGCAGCAGCGTGGAGAAGTACATCAT

CGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTGACCGTGCGGGTGCCCATTGCTGTGGGCGAGTCTGATTTCGAGAACCTCAACACAGAGGAT

GTTAGCAGCGAGTCAGACCCCGAAGGCAGCAAAGAC AAACTGGACGATACCAGCTCCTCAGAAGGGAGTACCATCGACATCAAGCCTGAGGTGGAAGAA

GTCCCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACGCCTGCTTCACGGAGG GTTGTGTCCAGAGGTTCAAGTGCTGCCAGGTCAACATCGAGGAA

GGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCTTCCTCATTGTGGAGCACAATTGGTTTGAGACCTTCATCATTTTCATGATTCTCCTCAGCA

GTGGAGCCCTG GCCTTCGAGGACATCTACATTGAGCAGAGGAAGACCATCCGTACCATCCTGGAGTATGCGGACAAGGTCTTCACCTACATCTTCATCC

TGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAAGTTCTTCACCAATGCCTGGTGCTGGTTGGACTTCCTCATTGTGGCT GTCTCTTTAGTCA

GCCTTATAGCTAATGCCCTGGGCTACTCGGAACTAGGTGCCATAAAGTCCCTTAGGACCCTAAGAGCTTTGAGACCCTTAAGAGCCTTATCACGATTTGA

AGGGATGAGG GTGGTGGTGAACGCCTTGGTGGGCGCCATCCCCTCCATCATGAACGTGCTGCTGGTGTGTCTCATCTTCTGGCTGATTTTCAGCATCAT

GGGCGTTAACCTGTTTGCTGGGAAATACCACTACTGCTTCAACGAGACTTCAGAAATCCGGTTCGAAATCGACGAGGTGAACAATAAAACCGACTGTGAG

AAGCTCATGGAGGGCAACAACACAGAGATCCGATGGAAGAACGTCAAGATCAACTTCGACAACGTCGGGGCAGGCTACCTGGCCCTTCTTCAAGTG GCA

ACCTTCAAAGGCTGGATGGACATCATGTATGCAGCTGTAGATTCCCGAAAG CCGGACGAGCAGCCTGATTATGAGGGCAACATCTACATGTACATCTAC

TTCGTCATCTTCATCATCTTCGGCTCCTTCTTCACCCTCAACCTGTTCATCGGTGTCATCATCGACAATTTCAATCAACAGAAGAAAAAG TTTGGAGGT

CAGGACATCTTCATGACAGAGGAACAGAAGAAGTACTACAACGCCATGAAGAAGCTAGGCTCCAAGAAGCCACAGAAGCCCATCCCCCGACCTTTG AAC

AAAATCCAAGGGATTGTCTTTGATTTCGTCACGCAACAAGCCTTCGACATCGTGATCATGATGCTTATCTGCCTTAACATGGTGACCATGATGGTGGAGA

CAGACACACAGAGCAAGCAGATGGAGAACATTCTCTACTGGATTAATCTGGTCTTCGTCATCTTCTTCACCTGCGAGTGTGTGCTCAAAATGTTTGCCTT

GAGACACTACTATTTCACCATTGGCTGGAACATCTTTGACTTTGTGGTGGTCATTCTCTCCATTGTGG GAATGTTCCTGGCTGATATCATTGAGAAGTA

CTTCGTCTCCCCGACCCTATTCCGCGTCATCCGATTGGCCCGCATCGGGCGCATCTTGCGTCTGATCAAGGGCGCCAAAGGGATCCGCACCCTGCTCTTT

GCCTTAATGATGTCGCTGCCCGCCCTGTTCAACATCGGCCTCCTGCTCTTCCTGGTCATGTTCATCTTCTCCATCTTTGGGATGTCCAACTTCGCGTACG

TGAAGCACGAGGCCGGCATTGATGACATGTTCAACTTCGAGACGTTTGGCAACAGCATGATCTGCCTGTTCCAGATCACGACCTCTGCTGGTTGGGATGG

CTTACTGCTGCCAATCCTGAACCGCCCCCCTGACTGCAGCTTGGACAAGGAGCACCCAGGAAGTGGCTTCAAAGGGGACTGCGGGAACCCCTCCGTGGGC

ATCTTCTTCTTCGTCAGCTACATCATCATCTCCTTTCTGATCGTGGTAAACATGTACATTGCCATCATCTTGGAGAACTTCAGCGTAGCCACAGAGGAAA

GCGCCGATCCTCTGAGCGAGGACGACTTCGAGACTTTCTATGAGATCTGGGAGAAGTTTGATCCTGATGCCACCCAGTTCATCGAGTACTGTAAGCTGGC

CGACTTTGCCGACGCCCTGGAGCATCCGCTCCGAGTACCCAAGCCCAACACCATCGAGCTCATCGCCATGGACCTGCCCATGGTGAGCGGAGATCGAATC

CACTGCTTGGACATCCTTTTCGCCTTCACCAAGCGAGTCCTGGGAGACAGTGGGGAGTTGGACATCCTGCGGCAGCAGATGGAGGAGCGGTTCGTGGCGT

CCAATCCTTCCAAAGTGTCTTACGAGCCTATCACGACCACTCTGCGGCGCAAGCAGGAAGAGGTGTCTGCAGTGGTCTTGCAGCGTGCTTACAGGGGACA

CCTGGCTAGGCGGGGCTTCATCTGCAGAAAGATCACTTCCAACAAGCTGGAGAATGGAGGCACCCACCGAGAGAAGAAGGAGAGCACCCCGTCCACAGCC

TCCCTCCCCTCTTACGACAGCGTGACAAAGCCCGACAAGGAGAAGCAGCAGCGGGCAGAGGAAGGCAGGAGGGAAAGAGCCAAGAGGCAAAAAGAAGTCA

GGGAGTCCAAGTGCTAGAGGAGAGGGTAAGGGAAGCTTACGCTGGCTGAACACGGGCAAGTGAAAGCTTGTTTACAAACTTCCGAATCTCACGGACACAG

AGCAGCTGCGGAGATGCTGTACTGGAAGACCTATACCAAACATAGTCTGCTTACACGTGACACGGTTGCATCCTGAGCGGTGACCTGCTGGGGACAAAGG

ACCCTGCTCCCTGGACTCACAGATTTTTTCTATCGCTTGGGCAGACGTTACTGCATGTTCCACACTCGGTCAATGCAACTTAGGAGTAAACTTAACAGGA

TACAAACAGAGGCGGCTGCCAGGACCAGCAGATCGCCGCTGCAGCCAAATGGATTCTATTTTTTTTTTCATTTTGTTGATTCTCAGAAGCAGAAAGCATC

ACTTTAAAAGTTTGTTTGTTCATGCAAACAATATTTGCATTCTTACATTAGTTAAGCTAAGCAGCAAAAAGAAACACACACACATACAGACACACAAAGA

CACACACAGACACATACACACACACACACACATTCAGCCTATGTCACTAATCGTCTGTTTCTTTAACATAACAGCATCTTCTCCACGTGGGTGGCACATG

GTTTGGAGACGGTGGGGGAAACAATCAGGGTTTCAGGCTGAGGAGGACTTGCTCAGGCCAATTCCAAATATTGTGCTCGTTCAATGCGTAGAAATGACTT

GCATGATGGCATGCTGTGTTCAGAAGTCATGCATGAGGTCCATACACCAACAGACACTAGCAATCCTGTCCCTCGCATTGGCTCAGCCTTCGGACAGGAC

CCAGCCCTGCACTGTTCACTGTATTTGGAGAAATGGTAAGAGTTCCATACCGGCTGCAATCCTCTCAGTGTACAAGTCTTTCATACACCTCTGGGTAGGG

AGACATAATTAACCAATTGACCACTACCAACAAAAACAACCCAACCAAACAAGCAGATGGATCCGCTGCATATACATGTTTGACAGACATCTCTGACATA

CAGCCATTGTCGTACATTTTGCTGCTCTGTCCAATACATGGGGAGACTCTGGCCCCGAATGGCTTGTACTATTAATGTCACTGTAAAACCAAATCCTAGG

GCTAAAAAAAAAAAAAAAAAGAAAAAAGAAAAAAAAAAGAAAAATACTAATAGAAAAAAGAGTTCATTTGTATCTTGCAATATCCTGTTGATTGTTTAGC

CTTCATCCTGGAGAACTGACCCTGGGGTAGAGATAAAAGTGCTATGTATTGTAGCATGTTACCTCTAGGGGGCCTTTGGGGGGCTTACAGAAACCTTGTG

GGGGGTTTGGGGTGCTTATTGCATTCAGTGTCATGTCTGTCTGCTTTTCTCCAGGCTCAGGTAGATACGGAAAGGGGTTCAGATATTCTGAACTGCCCTG

TCCTGCAGAGGGGTTGTCACAAGCTCCTGGCTGCACGGTTCTTCCTGCTTCTGCCATATCCCTCCAGCCAGCAGGGCTCCCCTTCCCAGCCGCTCAGGGC

TGGCAAGGACAGCAGTGTTGGCTGAGATAAGGCTGTAGGCTCTTCCATTTGTAGAATAACGCTCTCTAACAGGACCTGATGGAAAGATGGAGCTGCCTCT

GGACAGAGCCCACTTGGTCTTGTTTCTACGACGGCTTTTGTGAGAAAGGGACTCAGTAGTCATTCTTTAGGGTGTCACAGCTTCCCCTGGCCTTTCCTTT

CAGCTCACCTTGCTTTCTGCTTAGTGGCCTGCCCACTGTTGTTGGGGGATGGCTTCTAGAGGGGCGTCATATCTTCCATTCCATCCCCCACTTTATAGAA

GACAGTTCTTAGTCCAGGGTGTCTCAGCTGACCACAAGGTCTCAAAGCCAAGATGCTGCACTCGAATGCCAGAAAGTCTCTCTGAACCAAATCAACACAA

ACTCTCCCTGAGCATAGTATGGAGGGAATCGAGTGGCCCATCAGTAGACACATCAGATGCACCAGTCCGCCTTGCAGTAGAAGCACTTTGGATGTAATCT

CACAGTCCACCTGACTAGTTTTGCATAGAACAAACCACAGCCAGTCAGTGAGCAGAGCTTTCTATCTTCTTGGACCGGTAGACACTGTCCAACTCTCCCA

GCTCAGAGAGTGTGTCCGTGTCACCACAGCTAGGACAATTCTAGAGCGCCACCTGCAGGCAACATCGCAAACAGCACAAAACAGGAGCTGACCTGTGGTT

ATTCTTTTTAAGAGAATTATAAATACTGTAATATATAATTTTATTTTATTGGCATGCCTTTTTGTAAATACAAATTACTAACTTATTAAATAGGAAATGG

CTTCTGGCTTACGCCATTGTCATGGTTATTTTTATTTTTTATACTTTCCTTTCTTCTTAGAATTTAGAAGCTGTCAGCCAATGTATACCCCTAACCAGAC

AGACAGACAAAAAATTTTTTATTGCTAATGGTATTTTCCAAAACAACAAAATATATATATATTTTTGTTCCAATGTGCAATAAATTCTAACCACTTCTAT

GCAAGATTTGGCTAAACTCAATCATTGTTCTTAGATCTTGAGATGGGCAACAGCTATTTGATCCTGCTAGGAACACCAAGCGCCATGCTAGTAATGTTCA

GCGATTAGATCTGACCCTCCTACCCCAGCTCCTGACCCAGCCCAGCAGGCTGTGCCTCAGTTTCTCACACCCTCCAACAGCCTCGCAGGGAAGAAGCCAC

CTCCGAGTCTGCTTGCTCTAACTTTCACTCTGATCAGACCTCTCCCAGCAATGCCCCTCACCTTCCATCTGTCCACCCAGCCACTCTCTGCCCGCCTCGC

TCTCTCTGTCCCACTCCATGATCCTTTCTTGTGAACCACACCATCACCAGCAGTTCACACCCGCAGTTAACAGGCATCGAACCTTAAAGAATCAGCTACG

GCAGGTTTTGGTTGGTTTGGTTTTGTTTTGCGTCCTCATTGCGTGAGCAAGTGGCAGGGCTTTGCCAAATATTCATGAAGCCTGTCAAAGAGCGGCAGCA

GCCAGTACCACTGCACATATATATATAGATATATAAATATAATATAAATATTTATTTTTTGTAGCCGGGTCCTTGGTGCAGTATTTATATTCCACGATCC

TCCTTTAAAAATAATAATAATAATAATAAAAAGGACAAAAAAGCAAAAAGTCATGTGATGCTGTTCATTTAAAACGCAGAGCCAAAGCCCCTGAGCAGTA

GTCGCCATGACTACTGGTTGTGTGAAAACACTCCCTTCTTCCTTAACTTCCCTGTGGCTTAGGGTGAGAGGCTGGGAGTCACAGGGCAGAGGGTGGGAGC

AGGAAAGCCGAGTCTGAGTGATCTGCTCTCACCATCTGGAAATGAGCCACTTGGGCATCTGAAGCTGCGCACAGAGAGACAAGCTCCCCCTCAGGGCCCC

TGAAGCGACATAGAGTGCCCAAAGGGCTTCTCTCATCACCACAACCCACGTAAACTGTAAGAGACCCATAGTGTGCTAGTGAGTGCATGGAGCCTGATGC

TGCCCTAAACGATACCTGATCTTTAGAAAAGTAAATCACTATTAGCCAAAAGGAAACAAAATTTACAAAACAAACAAACAAACAAAAAATACGGCCCTTT

TTAACCACACAAGGGAAGCCCGTCTTGCTGTGTGTCTGTTTGACTTTCCAGTTATTGAGGTCTGGGAACTGGGACCCTGGAGCTTTGGGGAAGGAGAAAG

GAAAACAGAGCCCCCCCCCCCCAATTCTAAGTAGGTACTGCAGAGAAAAGCCAGGTCCTGACCCCCCAGGTCCCTGCTTACTGATTGCATGTGGCATTAC

CCCTTAGACTGGACCCCCCTCCCTCACCGTTTCCACCCAGCAGAGCCCCCCAGAGATGACTTCAACCAACCTAGCTGGTCTGGCCTTACTTCTGCCTTGT

TCATGGTTATGATTTAAGAAAGAAAGAAAAAAAAAAAACCTCTCCTGACCCCCCACCTCCCAAGGCTAGCGCAAGCACGCTGCCCGGCAGCTTCCAGTCC

ACCAGCTCGTGCTGGCCCTGCCTTCCATCCACTCCCATTATCAGACCGGCAGACTGGGGCTGTCCCCTTCACATTTGTGCAGGGGAGGGGGCATCCCTTG

GGGACATCCCTCTCCAGGCCATGTCTCCTGGTCTAGGAACACTCAGGAGGATCTTGAAGTGCCCACTCTAGTCCACTCTAGTAGCTGAACTAGAGAGAGT

CGGCTGGTAGGTCAGTCCCTGTCCTTGTCCCTCAGCTCCAGCCTCCAGGCCTTCTGTGGAGGTGAAATTGCCATGGGTCCGGACATGGTGACCTGAACCC

TGGGCATCTTCTGGAACGATGCCTCTTTCTTTTCTCAGATGTTGCCCAAAGTTTTGCAAAAAGCTTCCTTCATTTTCAGGTACTCCCCCGCCCCCTAAAG

AATTAGCTGCCGTCAGTCAGCCAGGGGGGTCAGGAGAAGAGGAAGTCTGGGTTCAGAGGACAAGACTTGCACCCCGGCCTGTGCTTCTTGCCTCTTCTCA

AGACTGCCAAGATTTCCTCCATTAAAACACTCCTGAGGCACCCCTGCCCCTGACCCCACTGCTGTTTGCTGTACATAGAGGCTAAGTGGGGTGAAGTGGG

CAGGTGTGCACATGTATGTGTGTGTGTGTGTGAAGAATGTACATAGGTAAAGGGGAGCGTGGTCCAGTGGTTCCAGAAGAGGGACAGAACTGTGTTCCAT

CCCTAGCTTGACCACTGGCTCGCTGTGTGGCCTTGGGCAAGTCACTTAACCTCTCTGTGCCTCAGTTTCCCCATCTGTAAAATGGGGGTAATAATACTGA

CCTACCTCACAGGGGTGTTGTGAGGCTTTAACTAGATGTTTTGTAAAGCGTTCTGAGATACAGAGACAAAGGCGCCAGGGAAGGGCAAAGTATTCTTTGG

ACTTGAGGAAGAGGAACTAGTACCATAAACGCTGCTATTCTGAGAGCCATTTTAAACTGCACTGCTCCACCACCCCCCGCTTCTCATCACCAGGACAGCA

GGTCGAGAAATGTCTTTCCTTGCACTTGCTTCTGGGGTTTGTGATTCTTCTGATTTTTCCCTTTGCTGTATCTCCTTCCTTACCCCTCCACTCGTTCCCT

GTTCTGTTAATGCGGAAATGGCAGAAATGCTTGAGAAATGAGAATGTATAAGTGGATTGGAAGTTTATAGTCTGGATTTTCAATTTTACTTTGTACTGTA

CATCTTTTTACTTTAGAATTTGCAATAAAGGGTTACGTCAATCTTGTTTTCAACTCTC
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSF - UNI21539 - FFSMIIMCTILTNCVFMTFSNPPEWSKNVE EYTFTGI

YTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMA - UNI30196 - AYITEFVNLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKL

SDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKT TNFYMVPGMLEPLLCGNSSDAG GQCPEGFQCMKAGRNPN

YGYTSFDTFSWAFLALFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEA

Q AAAMATSAGTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQ

 SLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVD

CNGVVSLIGPGSHIGRLLPE ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMSVVTNTLVEE ELEESQRKCPPCWYKFANTFLIWECHPYWIKLK

EIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNL VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSV

LRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISQECKLPRWHMNDFFHSFLIVFRVLCGEWIETM

WDCMEVAGQAMCLIVFMMVMVIGNLV VLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEK

KANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKD KLDDTSSSEGSTIDI

KPEVEEVPVEQPEEYLDPDACFTEG GCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGAL AFEDIYIEQRKTIRTILEYAD

KVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVA VSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVC

LIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDCEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRK PDEQP

DYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKIQGIVFDFVTQQAFDIVIMM

LICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVG GMFLADIIEKYFVSPTLFRVIRLARIGRIL

RLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHP

GSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIE

LIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICRKITSNKLENG

GTHREKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRRERAKRQKEVRESKC
Transcript ENSMUST00000082209
Sequence
GGAGCTGGGAGCGAAGAAGGCAGGCGAGCGGGCGAGCGGGCGGCCGGGCGCGCCCGGCAGG - UNI26909 - AGCCGACCTGTCCCGGACTCAGCAT

AACTAACGAAGCTGCTGCAGAATGAGAAGATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAAA

CATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGACGATGAAGACAGCAAGCCCAAGCCAAACAGT

GACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGGGACATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGC

AGAAA ACTTTTGTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCCTTTTAACCTGATAAGAAGAA

TAGCTATTAAAATTTTGATACATTCAT - UNI21539 - TCTTCAGCATGATCATCATGTGCACCATCCTGACCAACTGTGTATTCATGACTTTTAGT

AACCCTCCCGAATGGTCCAAGAATGTGGA GTACACATTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGAC

GGCTTCACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGC - UNI30196 - ATATGTGACAGAGTTTGTGGACCTGGG

CAATGTCTCAGCGCTGAGAACATTCAGGGTTCTCCGAGCTTTGAAAACTATCTCTGTAATTCCAG GCCTGAAGACAATCGTGGGCGCCCTCATCCAGTC

TGTGAAGAAGCTGTCAGACGTGATGATCCTGACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG

TGTGTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGGAGTATATCAACAATAAAA CAAACTTTTAC

ATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAGCTCTGACGCCGG GCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCC

AACTACGGCTACACCAGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGAACTTATACCAGCTG ACC

TTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGTGGGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGG

CTTACGAAGAGCAGAACCAGGCAACACTGGAGGAGGCAGAGCAGAAAGAGGCAGAGTTCAAGGCGATGCTGGAGCAGCTCAAGAAGCAGCAGGAGGAGGC

GCAG GCTGCTGCAATGGCCACTTCGGCGGGCACCGTCTCAGAAGATGCCATTGAAGAAGAAGGGGAAGATGGGGTAGGCTCTCCGAGGAGCTCATCTGA

GCTGTCTAAACTCAGTTCCAAGAGCGCGAAGGAGCGTCGGAACCGACGGAAGAAGAGGAAGCAGAAGGAGCTCTCTGAAGGGGAGGAGAAGGGGGACCCC

GAGAAGGTGTTTAAGTCAGAGTCGGAAGATGGCATGAGAAGGAAGGCCTTCCGGCTGCCAGACAATAGGATAGGGAGGAAATTTTCCATCATGAATCAG 

TCGCTGCTCAGCATCCCAGGCTCGCCCTTCCTTTCCCGACACAACAGCAAAAGCAGCATCTTCAGCTTTCGGGGTCCTGGACGGTTCCGGGACCCCGGTT

CGGAGAACGAGTTCGCAGACGACGAGCACAGCACAGTGGAGGAAAGTGAGGGCCGGCGCGACTCGCTCTTCATCCCGATCCGCGCCCGCGAGCGCCGCAG

CAGCTACAGCGGCTACAGCGGCTACAGCCAGTGCAGCCGCTCGTCGCGCATCTTCCCCAGCCTGCGGCGCAGCGTGAAACGCAACAGCACCGTGGACTGC

AATGGCGTGGTGTCGCTCATCGGGCCTGGCTCGCACATCGGGCGGCTCCTGCCTGAGGTGAAAATAGATAAGGCAGCTACAGACAGT GCAACAACTGAG

GTGGAGATTAAGAAGAAAGGCCCTGGATCGCTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGAAGGACAGAATCAACAGTATAATGAGCGTTG

TCACAAACACACTAGTGGAAG AGCTGGAAGAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGTTTGCCAATACTTTCCTCATCTGGGAGTGTCACC

CCTACTGGATAAAACTGAAGGAGATTGTGAACCTGATCGTCATGGACCCTTTCGTAGACTTAGCCATAACCATCTGCATTGTCCTGAACACACTATTTAT

GGCAATGGAGCACCATCCCATGACGCCACAATTCGAACATGTCCTGGCCGTAGGGAACCTG GTGTTCACTGGGATCTTCACGGCGGAAATGTTCCTGAA

GCTCATAGCCATGGATCCCTACTATTACTTCCAAGAAGGCTGGAACATTTTTGACGGATTTATCGTCTCCCTCAGTTTAATGGAGCTGGGCCTTGCAGAC

GTGGAGGGGCTCTCAGTGCTGCGATCTTTCCGATTG CTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCCACCCTGAACATGCTGATCAAGATCATTGGG

AACTCCGTTGGCGCCCTGGGCAACCTGACCCTGGTGCTGGCCATCATTGTCTTCATCTTTGCCGTGGTGGGGATGCAGCTCTTTGGAAAGAGCTACAAGG

AGTGCGTCTGTAAGATCAGCCAGGAGTGCAAGCTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTCATCGTCTTCCGAGTGCTGTGTGGGGA

GTGGATCGAGACCATGTGGGATTGCATGGAAGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGATGGTCATGGTCATCGGCAACCTGGTG GTGCT

GAACTTATTTCTGGCCTTGCTTCTGAGCTCCTTCAGCGCAGACAATCTGGCGGCCACGGACGACGACGGGGAAATGAACAACCTGCAGATATCGGTGATC

CGGATCAAGAAGGGCGTGGCCTGGGCCAAAGTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAACGGGAGGCTGATGAAGTGAAACCTTTAGACG

AGCTGTATGAGAAGAAGGCCAACTGCATCGCCAACCACACCGGCGTGGACATTCACAGGAACGGCGACTTCCAGAAAAATGGAAATGGCACCACTAGCGG

CATCGGCAGCAGCGTGGAGAAGTACATCATCGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTGACCGTGCGGGTGCCCATTGCTGTGGGCGAG

TCTGATTTCGAGAACCTCAACACAGAGGATGTTAGCAGCGAGTCAGACCCCGAAGGCAGCAAAGAC AAACTGGACGATACCAGCTCCTCAGAAGGGAGT

ACCATCGACATCAAGCCTGAGGTGGAAGAAGTCCCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACGCCTGCTTCACGGAGG GTTGTGTCCAGAGG

TTCAAGTGCTGCCAGGTCAACATCGAGGAAGGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCTTCCTCATTGTGGAGCACAATTGGTTTGAGA

CCTTCATCATTTTCATGATTCTCCTCAGCAGTGGAGCCCTG GCCTTCGAGGACATCTACATTGAGCAGAGGAAGACCATCCGTACCATCCTGGAGTATG

CGGACAAGGTCTTCACCTACATCTTCATCCTGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAAGTTCTTCACCAATGCCTGGTGCTGGTTGGA

CTTCCTCATTGTGGCT GTCTCTTTAGTCAGCCTTATAGCTAATGCCCTGGGCTACTCGGAACTAGGTGCCATAAAGTCCCTTAGGACCCTAAGAGCTTT

GAGACCCTTAAGAGCCTTATCACGATTTGAAGGGATGAGG GTGGTGGTGAACGCCTTGGTGGGCGCCATCCCCTCCATCATGAACGTGCTGCTGGTGTG

TCTCATCTTCTGGCTGATTTTCAGCATCATGGGCGTTAACCTGTTTGCTGGGAAATACCACTACTGCTTCAACGAGACTTCAGAAATCCGGTTCGAAATC

GACGAGGTGAACAATAAAACCGACTGTGAGAAGCTCATGGAGGGCAACAACACAGAGATCCGATGGAAGAACGTCAAGATCAACTTCGACAACGTCGGGG

CAGGCTACCTGGCCCTTCTTCAAGTG GCAACCTTCAAAGGCTGGATGGACATCATGTATGCAGCTGTAGATTCCCGAAAG CCGGACGAGCAGCCTGAT

TATGAGGGCAACATCTACATGTACATCTACTTCGTCATCTTCATCATCTTCGGCTCCTTCTTCACCCTCAACCTGTTCATCGGTGTCATCATCGACAATT

TCAATCAACAGAAGAAAAAG TTTGGAGGTCAGGACATCTTCATGACAGAGGAACAGAAGAAGTACTACAACGCCATGAAGAAGCTAGGCTCCAAGAAGC

CACAGAAGCCCATCCCCCGACCTTTG AACAAAATCCAAGGGATTGTCTTTGATTTCGTCACGCAACAAGCCTTCGACATCGTGATCATGATGCTTATCT

GCCTTAACATGGTGACCATGATGGTGGAGACAGACACACAGAGCAAGCAGATGGAGAACATTCTCTACTGGATTAATCTGGTCTTCGTCATCTTCTTCAC

CTGCGAGTGTGTGCTCAAAATGTTTGCCTTGAGACACTACTATTTCACCATTGGCTGGAACATCTTTGACTTTGTGGTGGTCATTCTCTCCATTGTGG G

AATGTTCCTGGCTGATATCATTGAGAAGTACTTCGTCTCCCCGACCCTATTCCGCGTCATCCGATTGGCCCGCATCGGGCGCATCTTGCGTCTGATCAAG

GGCGCCAAAGGGATCCGCACCCTGCTCTTTGCCTTAATGATGTCGCTGCCCGCCCTGTTCAACATCGGCCTCCTGCTCTTCCTGGTCATGTTCATCTTCT

CCATCTTTGGGATGTCCAACTTCGCGTACGTGAAGCACGAGGCCGGCATTGATGACATGTTCAACTTCGAGACGTTTGGCAACAGCATGATCTGCCTGTT

CCAGATCACGACCTCTGCTGGTTGGGATGGCTTACTGCTGCCAATCCTGAACCGCCCCCCTGACTGCAGCTTGGACAAGGAGCACCCAGGAAGTGGCTTC

AAAGGGGACTGCGGGAACCCCTCCGTGGGCATCTTCTTCTTCGTCAGCTACATCATCATCTCCTTTCTGATCGTGGTAAACATGTACATTGCCATCATCT

TGGAGAACTTCAGCGTAGCCACAGAGGAAAGCGCCGATCCTCTGAGCGAGGACGACTTCGAGACTTTCTATGAGATCTGGGAGAAGTTTGATCCTGATGC

CACCCAGTTCATCGAGTACTGTAAGCTGGCCGACTTTGCCGACGCCCTGGAGCATCCGCTCCGAGTACCCAAGCCCAACACCATCGAGCTCATCGCCATG

GACCTGCCCATGGTGAGCGGAGATCGAATCCACTGCTTGGACATCCTTTTCGCCTTCACCAAGCGAGTCCTGGGAGACAGTGGGGAGTTGGACATCCTGC

GGCAGCAGATGGAGGAGCGGTTCGTGGCGTCCAATCCTTCCAAAGTGTCTTACGAGCCTATCACGACCACTCTGCGGCGCAAGCAGGAAGAGGTGTCTGC

AGTGGTCTTGCAGCGTGCTTACAGGGGACACCTGGCTAGGCGGGGCTTCATCTGCAGAAAGATCACTTCCAACAAGCTGGAGAATGGAGGCACCCACCGA

GAGAAGAAGGAGAGCACCCCGTCCACAGCCTCCCTCCCCTCTTACGACAGCGTGACAAAGCCCGACAAGGAGAAGCAGCAGCGGGCAGAGGAAGGCAGGA

GGGAAAGAGCCAAGAGGCAAAAAGAAGTCAGGGAGTCCAAGTGCTAGAGGAGAGGGTAAGGGAAGCTTACGCTGGCTGAACACGGGCAAGTGAAAGCTTG

TTTACAAACTTCCGAATCTCACGGACACAGAGCAGCTGCGGAGATGCTGTACTGGAAGACCTATACCAAACATAGTCTGCTTACACGTGACACGGTTGCA

TCCTGAGCGGTGACCTGCTGGGGACAAAGGACCCTGCTCCCTGGACTCACAGATTTTTTCTATCGCTTGGGCAGACGTTACTGCATGTTCCACACTCGGT

CAATGCAACTTAGGAGTAAACTTAACAGGATACAAACAGAGGCGGCTGCCAGGACCAGCAGATCGCCGCTGCAGCCAAATGGATTCTATTTTTTTTTTCA

TTTTGTTGATTCTCAGAAGCAGAAAGCATCACTTTAAAAGTTTGTTTGTTCATGCAAACAATATTTGCATTCTTACATTAGTTAAGCTAAGCAGCAAAAA

GAAACACACACACATACAGACACACAAAGACACACACAGACACATACACACACACACACACATTCAGCCTATGTCACTAATCGTCTGTTTCTTTAACATA

ACAGCATCTTCTCCACGTGGGTGGCACATGGTTTGGAGACGGTGGGGGAAACAATCAGGGTTTCAGGCTGAGGAGGACTTGCTCAGGCCAATTCCAAATA

TTGTGCTCGTTCAATGCGTAGAAATGACTTGCATGATGGCATGCTGTGTTCAGAAGTCATGCATGAGGTCCATACACCAACAGACACTAGCAATCCTGTC

CCTCGCATTGGCTCAGCCTTCGGACAGGACCCAGCCCTGCACTGTTCACTGTATTTGGAGAAATGGTAAGAGTTCCATACCGGCTGCAATCCTCTCAGTG

TACAAGTCTTTCATACACCTCTGGGTAGGGAGACATAATTAACCAATTGACCACTACCAACAAAAACAACCCAACCAAACAAGCAGATGGATCCGCTGCA

TATACATGTTTGACAGACATCTCTGACATACAGCCATTGTCGTACATTTTGCTGCTCTGTCCAATACATGGGGAGACTCTGGCCCCGAATGGCTTGTACT

ATTAATGTCACTGTAAAACCAAATCCTAGGGCTAAAAAAAAAAAAAAAAAGAAAAAAGAAAAAAAAAAGAAAAATACTAATAGAAAAAAGAGTTCATTTG

TATCTTGCAATATCCTGTTGATTGTTTAGCCTTCATCCTGGAGAACTGACCCTGGGGTAGAGATAAAAGTGCTATGTATTGTAGCATGTTACCTCTAGGG

GGCCTTTGGGGGGCTTACAGAAACCTTGTGGGGGGTTTGGGGTGCTTATTGCATTCAGTGTCATGTCTGTCTGCTTTTCTCCAGGCTCAGGTAGATACGG

AAAGGGGTTCAGATATTCTGAACTGCCCTGTCCTGCAGAGGGGTTGTCACAAGCTCCTGGCTGCACGGTTCTTCCTGCTTCTGCCATATCCCTCCAGCCA

GCAGGGCTCCCCTTCCCAGCCGCTCAGGGCTGGCAAGGACAGCAGTGTTGGCTGAGATAAGGCTGTAGGCTCTTCCATTTGTAGAATAACGCTCTCTAAC

AGGACCTGATGGAAAGATGGAGCTGCCTCTGGACAGAGCCCACTTGGTCTTGTTTCTACGACGGCTTTTGTGAGAAAGGGACTCAGTAGTCATTCTTTAG

GGTGTCACAGCTTCCCCTGGCCTTTCCTTTCAGCTCACCTTGCTTTCTGCTTAGTGGCCTGCCCACTGTTGTTGGGGGATGGCTTCTAGAGGGGCGTCAT

ATCTTCCATTCCATCCCCCACTTTATAGAAGACAGTTCTTAGTCCAGGGTGTCTCAGCTGACCACAAGGTCTCAAAGCCAAGATGCTGCACTCGAATGCC

AGAAAGTCTCTCTGAACCAAATCAACACAAACTCTCCCTGAGCATAGTATGGAGGGAATCGAGTGGCCCATCAGTAGACACATCAGATGCACCAGTCCGC

CTTGCAGTAGAAGCACTTTGGATGTAATCTCACAGTCCACCTGACTAGTTTTGCATAGAACAAACCACAGCCAGTCAGTGAGCAGAGCTTTCTATCTTCT

TGGACCGGTAGACACTGTCCAACTCTCCCAGCTCAGAGAGTGTGTCCGTGTCACCACAGCTAGGACAATTCTAGAGCGCCACCTGCAGGCAACATCGCAA

ACAGCACAAAACAGGAGCTGACCTGTGGTTATTCTTTTTAAGAGAATTATAAATACTGTAATATATAATTTTATTTTATTGGCATGCCTTTTTGTAAATA

CAAATTACTAACTTATTAAATAGGAAATGGCTTCTGGCTTACGCCATTGTCATGGTTATTTTTATTTTTTATACTTTCCTTTCTTCTTAGAATTTAGAAG

CTGTCAGCCAATGTATACCCCTAACCAGACAGACAGACAAAAAATTTTTTATTGCTAATGGTATTTTCCAAAACAACAAAATATATATATATTTTTGTTC

CAATGTGCAATAAATTCTAACCACTTCTATGCAAGATTTGGCTAAACTCAATCATTGTTCTTAGATCTTGAGATGGGCAACAGCTATTTGATCCTGCTAG

GAACACCAAGCGCCATGCTAGTAATGTTCAGCGATTAGATCTGACCCTCCTACCCCAGCTCCTGACCCAGCCCAGCAGGCTGTGCCTCAGTTTCTCACAC

CCTCCAACAGCCTCGCAGGGAAGAAGCCACCTCCGAGTCTGCTTGCTCTAACTTTCACTCTGATCAGACCTCTCCCAGCAATGCCCCTCACCTTCCATCT

GTCCACCCAGCCACTCTCTGCCCGCCTCGCTCTCTCTGTCCCACTCCATGATCCTTTCTTGTGAACCACACCATCACCAGCAGTTCACACCCGCAGTTAA

CAGGCATCGAACCTTAAAGAATCAGCTACGGCAGGTTTTGGTTGGTTTGGTTTTGTTTTGCGTCCTCATTGCGTGAGCAAGTGGCAGGGCTTTGCCAAAT

ATTCATGAAGCCTGTCAAAGAGCGGCAGCAGCCAGTACCACTGCACATATATATATAGATATATAAATATAATATAAATATTTATTTTTTGTAGCCGGGT

CCTTGGTGCAGTATTTATATTCCACGATCCTCCTTTAAAAATAATAATAATAATAATAAAAAGGACAAAAAAGCAAAAAGTCATGTGATGCTGTTCATTT

AAAACGCAGAGCCAAAGCCCCTGAGCAGTAGTCGCCATGACTACTGGTTGTGTGAAAACACTCCCTTCTTCCTTAACTTCCCTGTGGCTTAGGGTGAGAG

GCTGGGAGTCACAGGGCAGAGGGTGGGAGCAGGAAAGCCGAGTCTGAGTGATCTGCTCTCACCATCTGGAAATGAGCCACTTGGGCATCTGAAGCTGCGC

ACAGAGAGACAAGCTCCCCCTCAGGGCCCCTGAAGCGACATAGAGTGCCCAAAGGGCTTCTCTCATCACCACAACCCACGTAAACTGTAAGAGACCCATA

GTGTGCTAGTGAGTGCATGGAGCCTGATGCTGCCCTAAACGATACCTGATCTTTAGAAAAGTAAATCACTATTAGCCAAAAGGAAACAAAATTTACAAAA

CAAACAAACAAACAAAAAATACGGCCCTTTTTAACCACACAAGGGAAGCCCGTCTTGCTGTGTGTCTGTTTGACTTTCCAGTTATTGAGGTCTGGGAACT

GGGACCCTGGAGCTTTGGGGAAGGAGAAAGGAAAACAGAGCCCCCCCCCCCCAATTCTAAGTAGGTACTGCAGAGAAAAGCCAGGTCCTGACCCCCCAGG

TCCCTGCTTACTGATTGCATGTGGCATTACCCCTTAGACTGGACCCCCCTCCCTCACCGTTTCCACCCAGCAGAGCCCCCCAGAGATGACTTCAACCAAC

CTAGCTGGTCTGGCCTTACTTCTGCCTTGTTCATGGTTATGATTTAAGAAAGAAAGAAAAAAAAAAAACCTCTCCTGACCCCCCACCTCCCAAGGCTAGC

GCAAGCACGCTGCCCGGCAGCTTCCAGTCCACCAGCTCGTGCTGGCCCTGCCTTCCATCCACTCCCATTATCAGACCGGCAGACTGGGGCTGTCCCCTTC

ACATTTGTGCAGGGGAGGGGGCATCCCTTGGGGACATCCCTCTCCAGGCCATGTCTCCTGGTCTAGGAACACTCAGGAGGATCTTGAAGTGCCCACTCTA

GTCCACTCTAGTAGCTGAACTAGAGAGAGTCGGCTGGTAGGTCAGTCCCTGTCCTTGTCCCTCAGCTCCAGCCTCCAGGCCTTCTGTGGAGGTGAAATTG

CCATGGGTCCGGACATGGTGACCTGAACCCTGGGCATCTTCTGGAACGATGCCTCTTTCTTTTCTCAGATGTTGCCCAAAGTTTTGCAAAAAGCTTCCTT

CATTTTCAGGTACTCCCCCGCCCCCTAAAGAATTAGCTGCCGTCAGTCAGCCAGGGGGGTCAGGAGAAGAGGAAGTCTGGGTTCAGAGGACAAGACTTGC

ACCCCGGCCTGTGCTTCTTGCCTCTTCTCAAGACTGCCAAGATTTCCTCCATTAAAACACTCCTGAGGCACCCCTGCCCCTGACCCCACTGCTGTTTGCT

GTACATAGAGGCTAAGTGGGGTGAAGTGGGCAGGTGTGCACATGTATGTGTGTGTGTGTGTGAAGAATGTACATAGGTAAAGGGGAGCGTGGTCCAGTGG

TTCCAGAAGAGGGACAGAACTGTGTTCCATCCCTAGCTTGACCACTGGCTCGCTGTGTGGCCTTGGGCAAGTCACTTAACCTCTCTGTGCCTCAGTTTCC

CCATCTGTAAAATGGGGGTAATAATACTGACCTACCTCACAGGGGTGTTGTGAGGCTTTAACTAGATGTTTTGTAAAGCGTTCTGAGATACAGAGACAAA

GGCGCCAGGGAAGGGCAAAGTATTCTTTGGACTTGAGGAAGAGGAACTAGTACCATAAACGCTGCTATTCTGAGAGCCATTTTAAACTGCACTGCTCCAC

CACCCCCCGCTTCTCATCACCAGGACAGCAGGTCGAGAAATGTCTTTCCTTGCACTTGCTTCTGGGGTTTGTGATTCTTCTGATTTTTCCCTTTGCTGTA

TCTCCTTCCTTACCCCTCCACTCGTTCCCTGTTCTGTTAATGCGGAAATGGCAGAAATGCTTGAGAAATGAGAATGTATAAGTGGATTGGAAGTTTATAG

TCTGGATTTTCAATTTTACTTTGTACTGTACATCTTTTTACTTTAGAATTTGCAATAAAGGGTTACGTCAATCTTGTTTTCAACTCTC
Translation
 - UNI26909 - MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDP

YYLTQK TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSF - UNI21539 - FFSMIIMCTILTNCVFMTFSNPPEWSKNVE EYTFTGI

YTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMA - UNI30196 - AYVTEFVDLGNVSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKL

SDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKT TNFYMVPGMLEPLLCGNSSDAG GQCPEGFQCMKAGRNPN

YGYTSFDTFSWAFLALFRLMTQDYWENLYQL TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEA

Q AAAMATSAGTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQ

 SLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVD

CNGVVSLIGPGSHIGRLLPEVKIDKAATDS ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMSVVTNTLVEE ELEESQRKCPPCWYKFANTFLIW

ECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNL VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMEL

GLADVEGLSVLRSFRL LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISQECKLPRWHMNDFFHSFLIVFR

VLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLV VLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADE

VKPLDELYEKKANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKD KLDDT

SSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEG GCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGAL AFEDIYIEQRK

TIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVA VSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMR VVVNALVGAI

PSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDCEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQV ATFKGWMDIMYAAV

DSRK PDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKIQGIVFDFVT

QQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVG GMFLADIIEKYFVSPTLFRV

IRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRP

PDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHP

LRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICR

KITSNKLENGGTHREKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRRERAKRQKEVRESKC

For any suggestions or comments, please send an email to unitrap@crg.es