Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023034 (Nr4a1)
Chromosomal location
Chr 15: 101097284 - 101105223 (+)
Description
nuclear receptor subfamily 4, group A, member 1 Gene [Source:MGI Symbol;Acc:MGI:1352454]
RefSeq_dna
NM_010444 
RefSeq_peptide
NP_034574.1 
UniGene
Mm.119 
MGI
MGI:1352454 
Uniprot/SWISSPROT
P12813 
Uniprot/SPTREMBL
Q545Q1 
Human Ortholog
ENSG00000123358 (NR4A1)
Omim not available
UniTrap UNI24005
Vector Insertion
Chr 15: 101097403 - 101100513
Public Clones D174C06 (ggtc) D050C12 (ggtc)
Private Clones OST238017 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32966
Vector Insertion
Chr 15: 101103625 - 101104426
Public Clones IST11910G7 (tigm) IST13795A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023779
Sequence
AGTGCAGGAGGCTGCGAAAGTTGGGGGAGTGTGCTAGAAGGACTGCGGAGCGGAGCGCACGCGGGACCAGGCTGCGACTGGGTCGCTGGTCCCGGCCACA

GGGAGTGGGAGCCGGCTGG - UNI24005 - AGATGCCCTGTATTCAAGCTCAATATGGAACACCAGCAACGAGCCCAGGACCGCGTGACCACCTGAC

CGGTGATCCCCTGGCCCTTGAGTTCGGCAAGCCTACCATGGACCTGGCCAGCCCCGAGACAGCACCTGCCGCACCTGCTACACTGCCCAGCTTCAGCACC

TTCATGGACGGGTACACCGGAGAGTTTGACACCTTCCTCTACCAGCTGCCGGGGACGACCCAGCCGTGCTCCTCAGCTTGTTCCTCTGCCTCCTCCACGT

CTTCTTCCTCATCCTCGGCCACCTCCCCCGCTTCGGCGTCCTTCAAGTTTGAGGACTTCCAGGTGTACGGCTGCTACCCGGGCACCCTGAGCGGCCCATT

AGATGAGACCCTATCCTCCAGCGGCTCTGAGTACTATGGCAGTCCCTGCTCAGCCCCCTCGCCATCTACACCCAACTTCCAGCCGTCCCAGCTTTCTCCC

TGGGACGGCTCATTTGGCCACTTCTCCCCGAGCCAGACTTATGAAGGCCTCTGGGCATGGACAGAGCAGTTGCCTAAGGCTTCTTCAGGGCCTCCGCCAC

CTCCAACCTTCTTCTCCTTCAGTCCTCCCACTGGCCCCAGCCCCAGCCTGGCCCAGAGTTCTCTGAAATTGTTCCCACCACCAGCCACCCACCAGCTTGG

GGAGGGGGAGAGCTATTCCATGCCAGCAGCTTTCCCCGGCTTGGCACCCACCTCTCCGAACCGTGACACTTCCGGCATTCTGGACGCACCCGTGACCTCC

ACCAAGTCCCGGAGCGGGGCTTCAGGTGGCAGCGAGGGCCGCTGTGCAGTCTGTGGTGACAATGCTTCGTGTCAGCACTATGGGGTCCGCACCTGTGAGG

GCTGCAAGGGCTTCTTCAAG CGCACAGTACAGAAAAGCGCCAAGTACATCTGCCTGGCAAACAAGGATTGCCCTGTGGACAAGAGGCGGCGGAACCGCT

GCCAGTTCTGCCGCTTCCAGAAGTGCCTGGCTGTGGGCATGGTGAAGGAAG TTGTACGGACAGACAGCCTAAAAGGGCGGCGGGGCCGGCTACCTTCAA

AACCCAAGCAGCCTCCAGATGCCTCCCCTACCAATCTTCTCACTTCCCTCATCCGGGCACACTTGGACTCCGGGCCTAGCACTGCCAAATTGGACTATTC

CAAG TTCCAGGAACTGGTGCTGCCCCGCTTCGGGAAGGAAGATGCCGGTGACGTGCAACAATTTTATGACTTGCTCTCTGGTTCCCTGGACGTTATCCG

AAAGTGGGCAGAAAAAATCCCTGGCTTCATTGAGCTTTGCCCAGGAGACCAAGACCTGTTGCTAGAGTCTGCCTTCCTGGAACTCTTCATCCTCCGCCTG

GCATACCG ATCTAAACCCGGTGAGGGGAAGCTCATCTTCTGCTCAGGCCTGGTACTACACCAGCTGCAGTGTGCCCGTGGCTTTGGTGATTGGATTGAC

AACATCCTGGCCTTCTCACGGTCCCTGCACAGCTTGGGTGTTGATGTTCCCGCCTTTGCCTGCCTGTCCGCTCTGGTCCTCATCACTG - UNI32966 

- ATCGACACGGGCTCCAGGACCCTCGTCGGGTGGAAGAGCTGCAGAATCGCATTGCTAGCTGTCTGAAGGAGCACATGGCTACCGTGGCAGGAGACCCA

CAGCCGGCCAGCTGCCTGTCACGTCTGCTGGGCAAACTGCCTGAGCTTCGGACCCTGTGCACTCAAGGCCTGCAGCGCATCTTTTGCCTCAAGTTGGAGG

ACTTGGTACCCCCTCCACCTATTGTGGACAAGATCTTTATGGACACATTGTCTTTCTGACCCCTGCCCTGAACATGTGTGCGCACACGTGCGTGCTCTTC

TGTCACCCATGTGCCTTTAAGCCTATAGCCCACGGACCCCCAGACCACCCTACCCCCAGCCTGGTTTTGAGCTAAGACTGACGTACCTCCTCACTCCAGA

AGATGGACAGAGAACTCAAGACCTGGGGGAGGGTGTGTATTCACGGGGGTGACCCCACTATTTGTCTTATCCCTCCAGCTCAGTCCTGGCCTTCGTGTGT

TTTTGTAAGATAAACCATTTTTAACACATACCACTCTGTTGTAAATAAGCTGACGCTACTGTAAATACAGAAAGGAAGAGGTTGAGATGGGGGTTGGGAG

GAAGGGGTGGGGCTCCCACCAGCTGGGCGAGCCTCCAACTCGAGATCTCTTCCGCTCTCCTTCCATGTGTACATAACTGTCACTCAAGAAGGTGATTGAC

AGATTCTGATTTATATTTGTGTATTTTCCTGGATTTATAGGATGTGACTTTTCTGATTAATATATTTAATATATTGAATAAAAAATAGACATGTAGTTG
Translation
 - UNI24005 - MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGYTGEFDTFLYQLPGTTQPCSSACSSAS

STSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLPKASSGP

PPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTSPNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRT

CEGCKGFFK RTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEV VVRTDSLKGRRGRLPSKPKQPPDASPTNLLTSLIRAHLDSGPSTA

KLDYSK FQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYR RSKPGEGKLIFCSGLVLHQLQCAR

GFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITD - UNI32966 - DRHGLQDPRRVEELQNRIASCLKEHMATVAGDPQPASCLSRLLGKLPEL

RTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF

For any suggestions or comments, please send an email to unitrap@crg.es