Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023050 (Map3k12)
Chromosomal location
Chr 15: 102328080 - 102347243 (-)
Description
mitogen-activated protein kinase kinase kinase 12 Gene [Source:MGI Symbol;Acc:MGI:1346881]
RefSeq_dna
NM_009582 
RefSeq_peptide
NP_033608.2 
UniGene
Mm.172897 Mm.402635 Mm.474809 
MGI
MGI:1346881 
Uniprot/SWISSPROT
Q60700 
Human Ortholog
ENSG00000139625 (MAP3K12)
Omim not available
UniTrap UNI30036
Vector Insertion
Chr 15: 102335520 - 102347244
Public Clones D145A11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023812
Sequence
GTGCTGCGGCCGCGGAGCCCCCGAG - UNI30036 - GGCCCGCTGCTCAGCACACCTGGCTCCAGAGGCCATGGCCTGCCTCCATGAAACCCGAACA

CCCTCCCCTTCCTTTGGGGGCTTTGTGTCTACTCTAAGTGAGGCTTCTATGCGAAAGCTGGATCCAGACACTTCAGACTGCACCCCCGAGAAAGACCTGA

CGCCCACCCAATGTGTACTTCGAGATGTTGTGCCTCTCGGTGGGCAGGGTGGAGGAGGACCCAGCCCCTCCCCAGGTGGAGAGCCTCCCCCAGAGCCTTT

TGCCAATAGTGTCCTCCAGCTACATGAGCAGGATACAGGTGGGCCAGGGGGAGCCACTGGGTCACCTGAGAGTCGAGCATCTAGAGTTCGAGCTGATGAG

GTACGTCTGCAGTGCCAGAGTGGCAGTGGCTTCCTTGAAGGTCTTTTTGGCTGCCTGCGCCCTGTCTGGACAATGATTGGCAAAGCCTACTCCACAGAAC

ACAAGCAACAGCAGGAAG - UNI30036 - ACCTTTGGGAAGTCCCCTTTGAGGAAATCCTGGACCTGCAGTGGGTAGGCTCAGGGGCTCAGGGTGCT

GTTTTCCTGGGACGCTTCCACGGGGAGGAGGTAGCTGTGAAGAAGGTTCGAGATCTCAAGGAGACTGACATCAAGCATCTTCGAAAGCTGAAGCACCCCA

ACATCATCACTTTCAA GGGTGTTTGCACACAGGCCCCCTGCTACTGCATCCTTATGGAATTCTGCGCTCAAGGACAGCTATATGAGGTGCTCAGAGCCG

GCCGCCCTGTCACCCCCTCCTTGCTGGTTGACTGGTCCATGGGCATCGCTGGTGGCATGAATTACCTGCACCTGCACAAGATTATCCACAGAGACCTGAA

GTCACCCAA CATGCTAATCACATACGACGATGTGGTGAAGATCTCAGATTTTGGCACTTCCAAGGAGCTGAGTGACAAGAGCACCAAGATGTCCTTTGC

AGGAACAGTAGCCTGGATGGCTCCTGAAGTGATCAGAAATGAACCTGTGTCTGAGAAGGTTGACATCTG GTCCTTTGGGGTGGTGCTATGGGAACTACT

GACTGGAGAGATTCCCTACAAAGATGTAGATTCCTCAGCCATCATCTGGGGTGTGGGAAGCAACAGTCTCCACCTGCCTGTACCCTCCAGCTGCCCAGAT

GGTTTTAAAATTCTACTTCGCCAGTGCTG GAACAGCAAACCACGAAATCGCCCATCATTCCGACAGATCTTGCTGCACCTGGACATCGCCTCCGCTGAT

GTGCTCTCTACACCCCAGGAGACTTACTTTAAGTCCCAG GCAGAGTGGCGGGAAGAAGTAAAACTGCACTTTGAAAAGATTAAGTCAGAAGGGACCTGT

CTGCACCGCCTAGAAGAGGAACTGGTGATGCGGAGAAGGGAGGAGCTCAG ACATGCCCTGGACATCAGGGAGCACTATGAACGGAAGTTGGAGAGAGCC

AACAACCTGTACATGGAACTGAATGCCCTCATGCTGCAACTAGAACTCAAAGAGAGGGAATTGCTCAG GCGAGAGCAGGCTTTAGAAAGGCGGTGTCCT

GGTCTACTAAAGTCACACCCTTCTCGGGGCCTCCTACATGGAAACACTATGGAGAAGCTCATCAAGAAAAGGAACGTGCCACAGAAACTGTCGCCCCACA

GCAAAAG GCCAGATATTCTCAAGACAGAGTCGTTGCTACCTAAACTAGATGCAGCCCTAAGTGGGGTGGGGCTTCCTGGGTGTCCTAAGGGCCCCCCTT

CACCTGGAAGGAGTCGGCGTGGCAAGACCCGTCACCGAAAGGCCAGTGCCAAGGGCAGCTGTGGAGACCTGCCTGGGCTTCGTGCAGCTTTGCCACCCCA

TGAGCCTGGAGGACTAGGAAGCCCAGGGGGCCTAGGAGTGGGCCCTTCAGCTTGGGATGCTTGCCCCCCTGCTCTCCGTGGACTCCACCATGACCTTCTA

CTCCGAAAGATGTCATCATCATCCCCAGACCTGCTATCAGCAGCGCTGGGAGCCCGAGGCCGAGGGGCTACAGGGGGAGCTCGGGATCCTGGCTCACCAC

CTCCACCCCAGGGCGATACTCCTCCAAGTGAGGGATCAGCTCCTGGTTCCACCAGCCCAGATTCGCCTGGGGGAGCTAAAGGGGAACCCCCTCCACCAGT

AGGGCCTGGAGAAGGTGTGGGGCTGCTGGGAACTGGAAGGGAAGGGACTGCAGGCCGGGGAGGAAACCGGGCTGGGTCCCAGCACTTGACCCCCGCTGCG

CTGCTGTACAGGGCTGCTGTGACTCGAAGTCAG AAACGTGGTATCTCATCTGAAGAAGAAGAAGGAGAGGTAGACAGTGAAGTAGAGCTACCCCCAAGT

CAAAG GTGGCCTCAGGGCCCGAACATGCGTCAGTCACTATCTACATTCAGCTCAGAGAACCCATCAGATGTGGAGGAAGGTACAGCTAGTGAGCCTTCC

CCAAGTGGCACACCAGAAGTTGGCAGTACCAACACTGATGAGCGACCAGATGAACGATCTGATGACATGTGCTCACAGGGCTCAGAAATTCCACTGGACC

TACCTACTTCAGAGGTGGTCCCTGAACGTGAAGCCAGCTCCTTGCCCATGCAACACCAGGATGGCCAG GGCCCCAATCCTGAAGACTCAGACTGTGACA

GCACTGAATTGGACAACTCCAACAGCATTGATGCCTTGCGGCCCCCAGCCTCCCTTCCTCCATGAAAGACACTCTTATTCCTTGTACATAGAGAAATATT

TATATAAATAATATATATGCGCCACATAATCAACAGATAGATGGGGCTTTCTTAGCCTTAAGCCAGGCTTGAGAGTGAACGACGCCCCTGACCAATTACC

GAATAAGTTCTGGGGACACTGGCAGCTGTGGAAATGAATGACTCCGAGTACTACCCTAGAGCTATAAAGAAAGGAAGCTGGCCCCTTCTTGCTTCACCCC

ATTCCTTATGTTGAACAAGCAAGTAGGCAATAGAAAAGCCAGGCTTGTCTCTATACTGTCTATCCCTGAACACTGGAGGGGCAGGTAGAGGATTCACTTA

AAACTGCACTTTTATTTTCCGTTTACTGTTTACACATTTTGCACTTGGGAGGAGGGAAAGAAACTAAGGCTGGGTCATCCCTCTGAGGTTTCTCAGGTGG

CAATGTAACTCATTTCTTTGTTCCTGTTTCTCTGCCCAAACCCTGGCTTTGGGCCAGACGACTAACAGCATGTGATGGCTCAGGCTGAAGAACTGGGGTG

CTGTTAGTCCCCACTGTTATCTTGGTGCCTGGTAGGGGTGGGGACTGTCATATTGTAACCCCTGTGAACAACCTTGAAATATAACCACTCCATGCAGGCC

CAACTGTCGAGGGTTTTCTTGGTGAATGAGTAGAGTGGTATAATACATGGTTTCAACTTGGATTTAAGATTTTATCTGAGGAATTTGGACAAGTTATTTT

CTAAGTTAACATAAATGATAGCAGGTAAACTTTTCTAAATGATTTCAGAACAAGGAGGTCTCAAAACACCTATGGAGAAAACTAAATGAACAATTACTAG

AACTTTAAAGTATGCAAGGTAGAACAAGGGGCAGCCATTCCCAAGTTTACTATCCTTACTATCCACGAGTTCCTGCCCAGCTCCATAAATGCACCAGCTG

CTCTACAATCCTAGGGTAAGTGTAATTGTCAATCTCCGTAAACAAGTTTTCAGAGGCTACCCAGTATCATGGAGGGGGAGGTGATTGAGGGCAAATTAAA

AAAATTGGAGTGGTAAAAAAGGGAAGAAAGTCCATTAATTCTATTGAAACTGAATCAGGGCTCTCTGGAAGTTAAAAGGTATAAAAATAACATCAGACAG

GAACAACACCCACGTAAGTCACTGTGGCATCCAGTTTCTATTCACAAAGAAAAAGCTCCAGTCCATCTTTTAATTTTTTTTTTTGAAAAATTCCTGACAT

TACAGAACTAAACTGAAATGTATTAATAATCCACTCTTACATTTCCATGACAAACAAAAATTCATGAGCCAAACAAAAACAAAAACCAAAAAACAAAAGG

GGGAGAAGCTTATAAAACTAAATATGGATATCTCAGCGTAACTGCTGAACAGAGAAAGGAATTAAAACACTTTAATTAAAAAATCATGAGTGGATGATAA

AGTGTGTAGAAACTGAAAATTTACAAACTATTTTAAAACCTGGAGTCGCTGACTGTTCAGAAACTACACAGATGGATCATGGGTGGTGAACAGCAGGATT

ATGGATGGGTCTGCTCTGTTCTAGCTGCTCCCCATGCCACCTGTCTCCGAGGAAAGCCTGTAAAACACAAAGAAGAATAAGTCAGCTTACCTAGCTACAA

TTCATCACACCAAGGTATTTCAAGGTTTCTTAGATTAGCTAGTACCATAGTGCACAAGGTTGTTTATGTAACACCACTACAACCAAGGTTCCTGAGGTGT

TCTCAGAAGAACATAACAAATGATGTTAAGTTGGTGACACTGTCTCTTCACGTTTTACTCTTTGCAAACTGAAAGCATTTCTAGAGAACATTAGGCTTCA

AGGAGTTGATCCTGTCGTGTTTACACTAGAACAGCCCACCAATGTGAAGGAACTTTGTGTTGGGAGCCTAACATTTAAAGATATTATGTAATTTTAACAA

TACTTAAAGGGAGGAGCAAGAATAGGAACTATAGTGAAAAATTGAATTATTGTTTTCAAGCTTATAATTTTAGGACAAATACCAACAAAAAAACAAGTAT

CAAAGCTTCAATTCAGTTCCTTAGCTCACTCTTCAAAATCCAAAACCTGTGGCCTTACTGGTACCAAATTCTCCTTGTAAACATACCTGGCTACAGTGCC

TTTCTACTTGTTTCAAATAGGTCATTTGAGGTCCTGGAATACAATTAAGCTTTGAGAGAAAGGCATTCAGTGTACATTTCATTATCACTGGGTAGCAGCA

AAATGCCTCATTCTGAACACAACTAGAGGTGTCTCAGGTCCACACCACAAGCTTAACTTCACAAAGAGCCAACTGACATCCATTTGTGATGTTTGGCTTA

ATACCATGTGCACTAAATGTACAAATACCACAGGGGAAGGGGTATATCCCGGAAACTAGAAGTCATTCTTCAATTAAAATATGTTTTCTTTAACGTC
Translation
 - UNI30036 - MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGGGGPSPSPGGEPPPEPFANSVLQLHEQ

DTGGPGGATGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQED - UNI30036 - DLWEVPFEEILDLQWVGSGAQGA

VFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFK KGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRD

LKSPN NMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIW WSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVP

SSCPDGFKILLRQCW WNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQ AEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR RHALDIRE

HYERKLERANNLYMELNALMLQLELKERELLR RREQALERRCPGLLKSHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKR RPDILKTESLLPKLDAALS

GVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRAALPPHEPGGLGSPGGLGVGPSAWDACPPALRGLHHDLLLRKMSSSSPDLLSAALGARGR

GATGGARDPGSPPPPQGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTAGRGGNRAGSQHLTPAALLYRAAVTRSQ KRGISSEEE

EGEVDSEVELPPSQR RWPQGPNMRQSLSTFSSENPSDVEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDLPTSEVVPEREASSLPMQH

QDGQ GPNPEDSDCDSTELDNSNSIDALRPPASLPP

For any suggestions or comments, please send an email to unitrap@crg.es