Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023051 (Tarbp2)
Chromosomal location
Chr 15: 102348890 - 102354105 (+)
Description
TAR (HIV) RNA binding protein 2 Gene [Source:MGI Symbol;Acc:MGI:103027]
RefSeq_dna
NM_009319 
RefSeq_peptide
NP_033345.2 
MGI
MGI:103027 
Uniprot/SWISSPROT
P97473 
Uniprot/SPTREMBL
Q3UNH9 Q99M41 
Human Ortholog
ENSG00000139546 (TARBP2)
Omim not available
UniTrap UNI11843
Vector Insertion
Chr 15: 102349034 - 102349552
Public Clones P110D02 (ggtc) (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24460
Vector Insertion
Chr 15: 102349723 - 102350905
Public Clones not available
Private Clones OST219366 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8056
Vector Insertion
Chr 15: 102351645 - 102352154
Public Clones RRJ189 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27169
Vector Insertion
Chr 15: 102352228 - 102352411
Public Clones not available
Private Clones OST67928 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100168
Sequence
CCGGGCTTGGCCCCGGCCCTAGCTCCTCGGCGGTGTACTGGGGTGCGTGGAGGCTGTAGTCACGGTGGCGCCCGCGGGGACGGAGGAGGGAATGAGTGAA

GAGGATCAGGGCTCCGGCACTACTACAGGCTGCGGGCTGCCCAG - UNI11843 - - UNI24460 - TTCTTTTTCTCTCCTAGACTCTTCACCGC

CTGAGGACACTCCTGTCGTTGCTGCAGAAGCTGCTGCCCCTGTTCCATCTGCTGTACTAACCAG - UNI8056 - GAGCCCTCCCATGGAGATGCAGC

CCCCTGTCTCTCCTCAGCAGTCTGAGTGCAACCCCGTCGGTGCTCTGCAG - UNI27169 - GAGCTGGTGGTGCAAAAAGGCTGGCGTTTGCCAGAG

TACATGGTGACCCAAGAGTCTGGGCCTGCTCACCGCAAAGAGTTCACCATGACTTGCCGGGTGGAGCGTTTCATTGAGATTG GCAGTGGCACTTCCAAA

AAGCTGGCAAAGCGTAACGCAGCAGCTAAGATGCTCCTTCGAGTGCACACTGTACCTCTGGATGCCCGGGATGGCAATGAGGCAGAGCCTGATGACGATC

ATTTTTCCATT GGCGTGAGCTCCCGCCTGGATGGACTGAGGAATCGTGGGCCAGGCTGCACCTGGGATTCCTTGCGGAATTCTGTGGGAGAAAAGATCC

TATCCCTTCGCAGTTGCTCCGTGGGCTCTCTAGGGGCTCTGGGCTCTGCCTGCTGCAGTGTCCTCAGTGAGCTCTCTGAGGAGCAGGCTTTCCATGTCAG

CTATCTGGATATTG AGGAACTGAGCCTGAGTGGGCTCTGCCAGTGCCTAGTGGAACTGTCCACCCAGCCAGCCACTGTGTGTTATGGTTCTGCAACCAC

CAGGGAGGCAGCCCGAGGTGATGCTGCTCACCGCGCCCTACAGTACCTCAGGATCATGGCGGGTAGCAAGTAGCATCCCACTGCAGTGATGGATATGCAT

CTTTTACTTCTTGCTCCTTCTGCCCCTGGGTCCATGTATCCACCTAGCTCTGGTACCCTCCAGAGGTGCCATCTCTACCTCTGACACAGCCTGTCTGCCT

TGAGACTGAGGAAGGCACAGGCAAGCAAGGAGCCATGAACCACAGGGCCCCAGCCAGCACAGGATTTGTCCTCATTCCGTGGGTGATGGATGAATCTATT

GGAGTCCTGAATAAATGCTGCTCTTTGGCTTCCAAAACCCTGCTCTCTCTGGCCTTGGGTCATGAGGGTATAAGGAATAAACATGGTGAGCTTGTTCTCC

TTTTG
Translation
MSEEDQGSGTTTGCGLPS - UNI11843 - - UNI24460 - SSFSLLDSSPPEDTPVVAAEAAAPVPSAVLTR - UNI8056 - RSPPMEMQPP

VSPQQSECNPVGALQ - UNI27169 - ELVVQKGWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIG GSGTSKKLAKRNAAAKMLLRVHTVPLDARD

GNEAEPDDDHFSI GVSSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSVGSLGALGSACCSVLSELSEEQAFHVSYLDIE EELSLSGLCQCLVELST

QPATVCYGSATTREAARGDAAHRALQYLRIMAGSK
Transcript ENSMUST00000023813
Sequence
CCGGGCTTGGCCCCGGCCCTAGCTCCTCGGCGGTGTACTGGGGTGCGTGGAGGCTGTAGTCACGGTGGCGCCCGCGGGGACGGAGGAGGGAATGAGTGAA

GAGGATCAGGGCTCCGGCACTACTACAGGCTGCGGGCTGCCCAG - UNI11843 - CATAGAGCAAATGCTGGCCGCCAACCCGGGCAAGACCCCGAT

CAGCCTTCTTCAGGAGTATGGGACCAGAATAGGAAAGACGCCCGTGTACGACCTTCTCAAAGCCGAGGGCCAAGCCCATCAACCTAATTTCACCTTTCGG

GTCACCGTTGGCGACACCAGCTGCACTG - UNI24460 - GTCAGGGCCCCAGCAAGAAGGCAGCCAAGCACAAGGCAGCTGAGGTGGCCCTCAAACA

CCTCAAAGGGGGGAGCATGCTGGAACCAGCCCTGGAGGACAGCAG TTCTTTTTCTCTCCTAGACTCTTCACCGCCTGAGGACACTCCTGTCGTTGCTGC

AGAAGCTGCTGCCCCTGTTCCATCTGCTGTACTAACCAG - UNI8056 - GAGCCCTCCCATGGAGATGCAGCCCCCTGTCTCTCCTCAGCAGTCTGA

GTGCAACCCCGTCGGTGCTCTGCAG - UNI27169 - GAGCTGGTGGTGCAAAAAGGCTGGCGTTTGCCAGAGTACATGGTGACCCAAGAGTCTGGGC

CTGCTCACCGCAAAGAGTTCACCATGACTTGCCGGGTGGAGCGTTTCATTGAGATTG GCAGTGGCACTTCCAAAAAGCTGGCAAAGCGTAACGCAGCAG

CTAAGATGCTCCTTCGAGTGCACACTGTACCTCTGGATGCCCGGGATGGCAATGAGGCAGAGCCTGATGACGATCATTTTTCCATT GGCGTGAGCTCCC

GCCTGGATGGACTGAGGAATCGTGGGCCAGGCTGCACCTGGGATTCCTTGCGGAATTCTGTGGGAGAAAAGATCCTATCCCTTCGCAGTTGCTCCGTGGG

CTCTCTAGGGGCTCTGGGCTCTGCCTGCTGCAGTGTCCTCAGTGAGCTCTCTGAGGAGCAGGCTTTCCATGTCAGCTATCTGGATATTG AGGAACTGAG

CCTGAGTGGGCTCTGCCAGTGCCTAGTGGAACTGTCCACCCAGCCAGCCACTGTGTGTTATGGTTCTGCAACCACCAGGGAGGCAGCCCGAGGTGATGCT

GCTCACCGCGCCCTACAGTACCTCAGGATCATGGCGGGTAGCAAGTAGCATCCCACTGCAGTGATGGATATGCATCTTTTACTTCTTGCTCCTTCTGCCC

CTGGGTCCATGTATCCACCTAGCTCTGGTACCCTCCAGAGGTGCCATCTCTACCTCTGACACAGCCTGTCTGCCTTGAGACTGAGGAAGGCACAGGCAAG

CAAGGAGCCATGAACCACAGGGCCCCAGCCAGCACAGGATTTGTCCTCATTCCGTGGGTGATGGATGAATCTATTGGAGTCCTGAATAAATGCTGCTCTT

TGGCTTCCAAAACCCTGCTCTCTCTGGCCTTGGGTCATGAGGGTATAAGGAATAAACATGGTGAGCTTGTTCTCCTTTTG
Translation
MSEEDQGSGTTTGCGLPS - UNI11843 - SIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTG - UNI2446

0 - GQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSS SSFSLLDSSPPEDTPVVAAEAAAPVPSAVLTR - UNI8056 - RSPPMEMQPPVSPQQ

SECNPVGALQ - UNI27169 - ELVVQKGWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIG GSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAE

PDDDHFSI GVSSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSVGSLGALGSACCSVLSELSEEQAFHVSYLDIE EELSLSGLCQCLVELSTQPATV

CYGSATTREAARGDAAHRALQYLRIMAGSK

For any suggestions or comments, please send an email to unitrap@crg.es