Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023068 (Nus1)
Chromosomal location
Chr 10: 52137365 - 52156570 (+)
Description
nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1196365]
RefSeq_dna
NM_030250 
RefSeq_peptide
NP_084526.1 
UniGene
Mm.199964 Mm.469448 
MGI
MGI:1196365 
Uniprot/SWISSPROT
Q99LJ8 
Human Ortholog
ENSG00000153989 (NUS1)
Omim not available
UniTrap UNI20047
Vector Insertion
Chr 10: 52137975 - 52148998
Public Clones not available
Private Clones OST374337 (lexicon) OST350779 (lexicon) OST318411 (lexicon) OST128580 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20493
Vector Insertion
Chr 10: 52149125 - 52149872
Public Clones not available
Private Clones OST360652 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9426
Vector Insertion
Chr 10: 52150023 - 52153150
Public Clones RRD189 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023830
Sequence
GCGGAGGGCGGAGGAAGATGGCGGCGGGGGCTAGGTGAGGTGTTGGCAGTGGCGAGGGGCTCGGGCGCGGGGGGTGGGGGGACGCGGAGCGATGGCCCGC

GCCGGCCGCTGGGGCGGATAAGACCCTGTCGCGCCGCGGGTGTGGGCCGGAGGGAGGTGACGGTGCCCGAGCGCCACAGGAGTATGACGGGGCTGTACGA

GCTGGTGTGGCGGGTGCTGCACGCGCTGCTCTGCCTGCACCTCACGCTCACCTCCTGGCTCCGCGTTCGCTTCGGCACCTGGAACTGGATCTGGCGGCGC

TGCTGTCGCGCCGCCTCCGCCGCGGTCCTAGCGCCGCTCGGCTTCACGCTCCGCAAGCCCCGGGCCGTCGGCAGGAACCGGCGTCATCACCGGCACCCGC

ACGGGGGACCGGGACCGGGACCGGGACCGGCCGCCACCCATCCTCGGCTGCGCTGGCGCGCGGACGTCCGGTCCCTGCAGAAGCTGCCGGTGCACATGGG

CCTGTTGGTCACGGAGGAAGTGCAGGAGCCCAGCTTCTCAGACATCGCCAGCCTCGTGGTGTGGTGTATGGCCGTGGGGATCTCCTACATTAGCGTCTAC

GACCACCAAG - UNI20047 - GTATTTTCAAGAGAAATAATTCCAGATTGATGGATGAAATTTTAAAACAGCAACAGGAACTTTTGGGCCAAGATTG

TTCCAAATACTCAGCAGAGTTTGCAAATAGTAATGACAAAGACGATCAAG - UNI20493 - ATTTAAATTGCCCTTCGGCAGTGAAGGTGCTGTCCC

CAGAAGATGGAAAAGCGGATATTGTGAGAGCTGCCCAGGATTTTTGCCAGTTAGTAGCCCAGCAGCAGAGGAAGCCCACAGATCTGGATGTAGATCTGCT

AGGCAGCTTACTTA - UNI9426 - GTTCACATGGGTTCCCTGATCCTGACTTAGTGTTGAAGTTTGGTCCTGTGGACAGCACATTAGGCTTTCTTCC

CTGGCAAATCAGATTGACTGAGATCGT CTCTCTGCCTTCTCACCTAAACATCAGCTATGAGGACTTCTTCTCCGCCCTTCGGCAGTATGCAGCTTGCGA

ACAGCGACTGGGAAAGTAATGGTCCCTACTTGCATAATTTGACTTCAGGCTTTTGGAGAAAAAGGACCCAAGTGACACTGATGTTTACAAAGTACCTATA

AAACCCTGTACACACC
Translation
MTGLYELVWRVLHALLCLHLTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQK

LPVHMGLLVTEEVQEPSFSDIASLVVWCMAVGISYISVYDHQG - UNI20047 - GIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQD

 - UNI20493 - DLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLS - UNI9426 - SSHGFPDPDLVLKFGPVDSTLG

FLPWQIRLTEIV VSLPSHLNISYEDFFSALRQYAACEQRLGK

For any suggestions or comments, please send an email to unitrap@crg.es