Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023087 (Ccrn4l)
Chromosomal location
Chr 3: 51028855 - 51055540 (+)
Description
CCR4 carbon catabolite repression 4-like (S. cerevisiae) Gene [Source:MGI (curated);Acc:Ccrn4l-001]
RefSeq_dna
NM_009834 
RefSeq_peptide
NP_033964.1 
UniGene
Mm.474178 
MGI
MGI:109382 
Uniprot/SWISSPROT
O35710 
Uniprot/SPTREMBL
B2RTJ8 Q3UEU2 
Human Ortholog
ENSG00000151014 (CCRN4L)
Omim not available
UniTrap UNI2209
Vector Insertion
Chr 3: 51029210 - 51051726
Public Clones XR0381 (sanger) (sanger) YTC380 (baygenomics) CSH840 (baygenomics) P103G05 (ggtc)
E079C12 (ggtc) P095H02 (ggtc) D025C03 (ggtc) IST14631B5 (tigm) IST14582C6 (tigm)
Private Clones OST450768 (lexicon) OST443316 (lexicon) OST418723 (lexicon) OST299739 (lexicon)
OST281121 (lexicon) OST262725 (lexicon) OST224898 (lexicon) OST208284 (lexicon)
OST155223 (lexicon) OST143990 (lexicon) OST125086 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19803
Vector Insertion
Chr 3: 51051997 - 51053618
Public Clones not available
Private Clones OST379901 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023849
Sequence
AGTGAGCCGCCGCTGCTGCCGCCGCCGCGTCTGCCTCCCGGCACAGCTCGCCCGGTCGGCGCCGAGGGACGAGGAGGAAGGAACACCCCGCAGCGCAGCG

GTCCCGCGCCACCCCCACCCCACCGTCGCCCGCCCAGCTCGGCCCGGCTCGTCAGCGCGGCGGCGCCCGGCATGTATCAGAGCCCGCGGCGGCTCTGCTC

GGCCCTGCTGCTCAGGGACGCCCCCGGCCTGCGCCGCACACTCGTGCCCGGCCCGCGCCGAACGCTCGCCCCGCCGGTGCTCGGATCTCGGCCCAAGTCC

CCGCAACTGCAGGCGGCGGCGGCCTCGGGCGCCGCGAGGTCGCGTCCCCGAACAG - UNI2209 - TGAGTTCCATGGGAAACGGCACCAGTCGACTC

TACAGTGCTCTCGCCAAGACCGTCAACAGCAGTGCAGCTGCTCAGCACCCGGAGTACTTGGTGTCAACTGACCCCGAACATCTGGAGCCCATCGATCCTA

AGGAACTTCTGGAGGAATGCAGGGCTGTTCTGCACACTCGGCCACCCCGCTACCAGCGGGATTTTGTGGACCTGAGGACAGATTGCTCCAGCAGCCACTC

TCCCATTCGCGTCATGCAGTGGAACATCCTCGCCCAAG - UNI19803 - CTCTCGGAGAAGGCAAAGACAACTTTGTGCAGTGCCCCGTGGAAGCGC

TCAAATGGGAAGAGAGGAAGTGCCTGATCCTGGAGGAGATCCTGGCTTACCAGCCAGACATACTGTGCCTCCAGGAAGTGGACCACTACTTTGACACCTT

CCAGCCACTCCTCAGTAGACTGGGCTACCAAGGCACGTTTTTCCCCAAGCCCTGGTCACCATGTCTAGATGTGGAACACAACAACGGTCCAGATGGCTGT

GCCTTATTTTTTCTCCAAAACCGATTCAAGCTTATCAGCAGCACCAATATTAGGCTGACAGCCATGACCCTAAAAACCAATCAGGTGGCCATCGCACAGA

CCCTGGAGTGCAAGGAGTCTGGGCGACAGTTCTGCATTGCTGTCACCCACTTAAAAGCCCGCACTGGCTGGGAGCGGTTCCGGTCAGCTCAGGGCTGTGA

CCTCCTCCAGAACCTGCAGAACATCACCCAGGGAGCAAAGATCCCCCTGATCGTCTGCGGGGACTTCAACGCAGAGCCAACCGAAGAGGTCTACAAACAC

TTTGCGTCCTCCAGCCTCAACCTCAACAGCGCCTACAAGCTGCTGAGTCCCGATGGACAGTCGGAGCCTCCCTACACAACCTGGAAGATCCGGACCTCAG

GCGAGTGTCGCCACACGCTGGACTATATCTGGTACTCCAGACATGCTCTGAGTGTCACGTCCGCCCTGGATCTACTCACTGAAGAACAGATTGGGCCCAA

CCGGCTCCCATCCTTCCATTACCCCTCGGACCACCTGTCCCTGGTGTGTGACTTCAGCTTTAACGAGGAGCCCCATGAGCTCTTTTAATCACAAGCGTCT

TAACCAGGGATGTTTTGGGAAACTGAACTAGGATAGGAAGTTGCCTGGAAAAGGACACCCAGTTTCTGCCACTACTCTCCATCATTTCCAGCATGCCCTT

GAAAAAACATTGTTCACAAACCTTTCCAGCTAAAACCCGCATTGAAAAGGTGTTTGCACTCCAGTTTGAGCTTGTTGTTCATCTGTGTACCATCCTCTAC

CATTTAGGGGCATTAGTAGCATAGGCTTTCTTGTTTTTTAGTTGAGGGTATTATAAAAACCCAGTTTGTAAGCCCTTCAGAATTAAAGTAAGATGTAGGA

AGTTTTCTAGACATCATTTCAAGTTATTTATTTGTGGGATTTTTAAATGTCAGTGGGAAAAAAAATGCATGGTAATATTTATTTTTTTATATCTTAATGT

AAAATAAAGTGGATTATCTAGCATTGTGGACATTTTAGAACCATGCAGGTACAGTCTTAATTCCTTAAAAATTAAAATGTCTCTATTTGCTGATCGAACA

GGATGTACACTAAGGAACTATTTAGCCCTGGGGGATTGGTGACTTTGTGTGTACATTCTTCACAAATAATTCCTGTTTGCTATGCCTTTGACTTCTCTGT

TGTGTTTTAAAGAAATTCCGTAGCATTCAGTTCTTTAGTTTCCACTGTTTAGTCACTGCTAGGCACTTGTGCCTTTTCTGTTGTGATGACGTTGGTAGAC

GTGTGAAGATTACTCCAATCACTTCTCCTGGGATGTGCTTTTTATAAGTAGCTTTAGGAACAGCTCTGGAACAGTTGCTAAGAATATTAGTGAGAAACCT

TGCCAAGACGACAGACATGAGCCCAACATTCAGCTGAGACAAGAAAGCTCACGTCTTGGAGGCCAGCTTGGGCTATATGTCAAGACCCTTTCTTGAAAAA

GCCAGATGACTGGATTCAAGTTTTCTAGAAAAATATAAGAGTCAAAAAGATAACCTGGAGTTCTCTTTCAATTGTTGAAGCCTCTTCCAAACAAAATATC

CTTCCAGTGGTAAAATGGTAAATATCTTAATGTATGAGTTCTAAATATTACTTAAGGTTAATAAATGGACTTAC
Translation
MYQSPRRLCSALLLRDAPGLRRTLVPGPRRTLAPPVLGSRPKSPQLQAAAASGAARSRPRTV - UNI2209 - VSSMGNGTSRLYSALAKTVNSSAAA

QHPEYLVSTDPEHLEPIDPKELLEECRAVLHTRPPRYQRDFVDLRTDCSSSHSPIRVMQWNILAQA - UNI19803 - ALGEGKDNFVQCPVEALKWE

ERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLISSTNIRLTAMTLKTNQVAIAQTLEC

KESGRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSPDGQSEPPYTTWKIRTSGECR

HTLDYIWYSRHALSVTSALDLLTEEQIGPNRLPSFHYPSDHLSLVCDFSFNEEPHELF

For any suggestions or comments, please send an email to unitrap@crg.es