Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023088 (Abcc1)
Chromosomal location
Chr 16: 14361653 - 14474965 (+)
Description
ATP-binding cassette, sub-family C (CFTR/MRP), member 1 Gene [Source:MGI (curated);Acc:Abcc1-001]
RefSeq_dna
NM_008576 
RefSeq_peptide
NP_032602.1 
UniGene
Mm.196634 Mm.408568 
MGI
MGI:102676 
Uniprot/SWISSPROT
O35379 
Uniprot/SPTREMBL
A5D6P3 Q3UDM1 Q8BRD0 Q8C7V6 
Human Ortholog
ENSG00000103222 (ABCC1)
Omim not available
UniTrap UNI24559
Vector Insertion
Chr 16: 14361737 - 14389899
Public Clones IST10948B10 (tigm) IST14591F8 (tigm)
Private Clones OST215303 (lexicon) OST193597 (lexicon) OST39962 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100167
Sequence
GCGGCGCTGCGCCTCCTCGCTCAGCCGGCCGCCCGCATGGCGCTGCGCAGCTTCTGCAGCGCTGATGGCTCCGATCCACTCTGG - UNI24559 - GA

CTGGAATGTCACATGGCACACCAGCAACCCCGACTTTACCAAGTGCTTTCAGAACACGGTCCTCACATGGGTGCCTTGTTTCTACCTCTGGTCCTGTTTC

CCCCTCTACTTCTTCTATCTCTCTCGCCATGACCGGGGCTACATCCAGATGACACACCTCAACAAAACCAAAACT GCCTTAGGATTCTTTCTGTGGATC

ATCTGCTGGGCAGACCTCTTCTACTCTTTCTGGGAAAGAAGTCAGGGAGTGCTCCGAGCCCCAGTGTTACTGGTCAGCCCAACACTGCTGGGCATCACCA

TG CTGCTCGCCACCTTTTTGATACAGCTTGAACGGAGGAAGGGAGTCCAATCCTCGGGAATTATGCTTACTTTCTGGCTCGTAGCCCTACTCTGTGCCC

TTGCCATCTTGAGATCTAAGATCATCTCTGCCTTAAAAAAG GATGCTCATGTGGACGTGTTTCGAGATTCCACGTTCTATCTGTACTTCACCCTTGTGC

TTGTTCAGCTCGTGCTGTCCTGCTTCTCAGACTGCTCACCCCTGTTCTCTGAAACTGTCCATGACCGG AATCCATGCCCAGAATCCAGTGCCTCTTTCC

TTTCCAGGATTACTTTCTGGTGGATTACAGG GATGATGGTGCACGGCTACCGCCAGCCCCTGGAGAGCAGTGACCTCTGGTCATTGAATAAGGAGGACA

CATCAGAAGAAGTGGTACCTGTGCTGGTGAATAACTGGAAGAAGGAATGTGATAAGTCAAGGAA GCAGCCTGTACGGATTGTGTATGCCCCTCCCAAAG

ATCCCAGCAAGCCTAAGGGAAGTTCCCAGTTGGATGTGAATGAGGAGGTGGAGGCACTGATTGTCAAGTCACCCCACAAGGATCGGGAGCCCTCTCTGTT

CAAGGTGTTATACAAGACTTTTGGTCCCTACTTCCTCATGAGCTTCCTGTACAAGGCCCTTCATGACCTGATGATGTTTGCCGGCCCCAAGATCTTGGA 

ATTGATTATCAACTTCGTGAATGACAGGGAGGCTCCCGACTGGCAGGGCTACTTTTACACAGCACTGCTGTTTGTCAGCGCCTGTCTGCAGACACTGGCA

CTCCACCAGTACTTTCATATCTGCTTCGTCAGTGGCATGCGCATCAAGACTGCTGTGGTGGGCGCTGTCTATCGTAAG GCTCTTTTGATCACCAATGCA

GCTAGAAAATCTTCCACGGTCGGAGAGATTGTCAACCTCATGTCCGTGGATGCTCAGCGCTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAG

CCCCTCTGCAAGTCATCCTAGCCCTCTACTTCCTGTGGCTG AGCCTGGGCCCTTCTGTGCTGGCTGGAGTGGCTGTGATGATTCTCATGGTACCCTTAA

ATGCTGTGATGGCCATGAAGACCAAGACCTACCAG GTGGCACACATGAAGAGCAAAGACAACCGAATCAAGCTGATGAACGAGATCCTCAATGGGATCA

AAGTCCTCAAGCTGTACGCCTGGGAGCTGGCCTTCCAGGACAAAGTCATGAGCATCAGGCAGGAGGAGCTCAAGGTGCTGAAGAAATCTGCCTACTTGGC

AGCTGTAGGCACATTCACGTGGGTGTGCACACCTTTCCTG GTGGCCCTGTCAACCTTTGCTGTCTTTGTGACTGTGGATGAGAGAAATATCCTAGATGC

AAAGAAAGCCTTTGTGTCCCTAGCCCTGTTCAATATCTTGCGCTTCCCACTCAACATCCTGCCCATGGTTATCAGCAGCATTGTGCAG GCCAGCGTGTC

CCTCAAGCGTCTCAGGATTTTTCTGTCTCATGAGGAGCTGGAGCCAGACAGCATTGAGCGGAGGTCGATCAAGAGTG GCGAAGGGAATAGCATCACTGT

GAAGAATGCAACCTTCACTTGGGCCAGGGGTGAACCTCCCACACTGAATGG CATCACCTTCTCCATTCCTGAAGGAGCCCTTGTGGCCGTGGTGGGCCA

GGTAGGCTGCGGGAAGTCATCTCTGCTGTCAGCCCTGCTGGCTGAGATGGACAAGGTGGAGGGACATGTGACTCTCAAG GGCTCCGTGGCCTACGTGCC

CCAGCAGGCCTGGATTCAGAATGACTCTCTCCGAGAGAACATACTGTTTGGGCACCCCCTGCAGGAAAATTACTACAAGGCAGTTATGGAAGCCTGTGCC

CTTCTTCCAGATTTGGAAATCCTGCCCAGTGGGGACCGCACAGAGATCGGTGAGAAG GGTGTGAACCTGTCAGGGGGCCAGAAGCAGCGTGTGAGCCTG

GCCCGGGCTGTGTACTCTAACTCTGACATCTACCTCTTTGATGACCCCCTCTCGGCTGTGGATGCACATGTTGGGAAGCACATCTTTGAGAAGGTGGTTG

GTCCCATGGGCCTACTGAAGAACAAG ACACGGATCCTGGTCACCCATGGTATCAGCTACCTGCCCCAAGTGGATGTCATCATTGTCATGAGTGGCGGCA

AGATCTCAGAGATGGGTTCTTATCAGGAGCTGCTAGACCGGGATGGGGCCTTCGCTGAGTTCCTGCGCACCTATGCCAACGCTGAGCAGGACCTGGCCTC

GGAGGATGACA GTGTCAGTGGTTCAGGGAAGGAGTCAAAGCCGGTGGAAAATGGGATGCTGGTGACAGACACCGTAGGAAAGCACCTGCAGAG GCATC

TCAGCAACTCGTCTTCCCACAGTGGGGATACCAGCCAGCAACACAGCAGCATAGCCGAACTGCAGAAGGCTGGAGCTAAGGAGGAGACGTGGAAGCTAAT

GGAAGCAGACAAGGCCCAGACAGGGCAG GTGCAGCTGTCAGTGTACTGGAACTACATGAAGGCCATTGGCCTCTTCATCACCTTCTTGAGTATCTTCCT

TTTCCTGTGCAACCATGTATCTGCACTGGCCTCTAACTATTGGCTGAGCCTCTGGACAGATGACCCCCCTGTTGTCAATGGGACTCAGGCGAACAGGAAT

TTTCGGCTGAGTGTCTATGGGGCCTTGGGCATCTTGCAAG GTGCAGCAATATTTGGCTACTCCATGGCTGTGTCCATCGGGGGCATCTTTGCCTCCCGT

CGCTTGCACCTGGACCTGCTATACAATGTTCTGCGATCACCCATGAGTTTCTTTGAGCGTACACCCAGTGGGAACCTAGTGAACCGATTCTCCAAGGAGC

TGGACACAGTGGACTCCATGATCCCGCAGGTCATCAAGATGTTCATGGGTTCACTCTTCAGTGTCATTGGAGCTGTCATCATCATCCTACTGGCCACGCC

CATTGCCGCAGTCATCATCCCACCCTTGGGTCTGGTTTACTTCTTTGTGCAG AGGTTCTATGTGGCTTCCTCAAGACAACTGAAGCGCCTGGAGTCTGT

CAGCCGTTCCCCTGTGTACTCACACTTCAATGAGACCTTGCTGGGAGTCAGTGTCATCCGTGCTTTTGAGGAGCAGGAGCGCTTCATTCACCAGAGTGAC

CTGAAAGTAGATGAGAACCAGAAGGCCTACTACCCCAGCATTGTGGCCAACAG GTGGCTTGCTGTGCGCCTTGAGTGTGTGGGCAACTGCATTGTGCTG

TTTGCTGCCCTCTTTGCAGTCATCTCCCGGCACAGCCTCAGTGCTGGCTTGGTGGGCCTCTCTGTGTCTTACTCACTGCAG ATAACTGCATACTTGAAC

TGGCTGGTTCGAATGTCCTCGGAGATGGAGACCAACATTGTGGCAGTGGAGAGACTGAAGGAGTATTCTGAAACAGAGAAGGAG GCTCCTTGGCAAATC

CAGGAAACAGCTCCACCCAGCACCTGGCCCCATTCAGGCCGTGTAGAGTTCCGGGATTACTGCCTGAGGTATCGAGAAGACTTGGACTTGGTTCTCAAGC

ACATAAATGTCACCATTGAGGGTGGAGAAAAG GTGGGTATTGTAGGTCGTACGGGAGCTGGGAAATCATCTCTCACCCTGGGTTTGTTCCGGATCAATG

AGTCTGCAGAAGGGGAGATCATCATTGATGGGGTCAACATCGCCAAGATCGGCCTGCACAACCTGCGCTTCAAGATCACCATCATTCCACAG GATCCTG

TTTTGTTCTCGGGTTCCCTCCGCATGAACTTGGACCCTTTCAGTCAGTATTCTGATGAAGAAGTCTGGATGGCCCTGGAGCTTGCTCACCTAAAGGGCTT

TGTGTCAGCTTTGCCTGACAAGCTGAACCATGAGTGTGCAGAAGGTGGAGAGAACCTGAG TGTGGGGCAGCGACAGCTTGTGTGCCTGGCCCGGGCTCT

GCTGAGGAAGACAAAGATTCTAGTGTTGGACGAGGCTACCGCAGCTGTGGACCTAGAGACAGATAACCTTATCCAGTCCACCATCCGGACACAGTTTGAA

GACTGTACTGTGCTCACGATTGCTCATCGGCTTAACACCATAATGGACTACACGCG GGTGATTGTCCTGGACAAAGGAGAAGTTCGGGAGTGTGGTGCA

CCCTCTGAGCTCCTGCAGCAAAGAGGCATCTTCTACAGCATGGCCAAGGATGCTGGCTTGGTGTGAGCTGGTCTCTGGCATATCCAATGAGGACTGCAGG

GCCAGGATCCCAGAGTCCAGGCATGAGCCAGCAACCCTGGAAACCTACGCTTCCCAGACAAAACCCAAAAATTTAAAACGAAACCAAACTAAAAGGAAGC

AAAATACTTAGGCGTCTGTCACCATTTGGCTTCATCCTGGATCTGACCTTGAAGAAGCTGGAAGACAGATGCACCCCACTTCAGATACACGTCTGGCCTC

TGGCACCCTGAAAGTTCACCCATGCTCCTGCCGTATCCCACGGCAAGTCCATGGGCAGCTAAACATACTAGTGACCAAACACAAGCCACACTGCCTCATG

TCTCTTCAGCCACGTCTACGGATGCCAAGCCTTGTAGCCTCTCCTGGCCTTGCCAGCTCTCTGTCACCTATAGTCGTGTTGGTTACAGAAGAGTGCATCT

TGCCTTCAGGTCTTGCAGTTGAAACATGGGAACCAAAATGAACAAAAAGGAGAGAAAGAAAACCCCTAAAAAGTTCCTGTCCTTGTTATGTCAGTGATGT

CCCCTTCCTGCCATCTGGTCTTCATGCACGCTGACACTGTCCCCTGCGTTCAGCACAGCTTTCACAGGACCTGCTTAAGACACAGCCTTGTGAAGGGACC

TAGGCAGACAGGCTTGGAACCCGGCCAGGCAACACTCCCTTCACAAGGACTTACACCTTGCCCCTGCTTTCTGTTTCTTCCTGTTCAAAGCTGGGGAGGG

CTCACTCCTCACATAAGGTCTATGAATAGTTATAAGCAGCAAAAGTCAAGAGCAGAAGGGATGGTGCCCACGGGCAAGAATCTGGTATCAAAGACAGCCA

GAGTTCCTTATAGGGCCAGAAGAGAACCATTCACAAATATCAGTGATTTCTCCCCCCTACTTATGAGCATCGTTTCGTGGAGAAGGATAGTCCCAAGAAT

TTGATGTCTGGGAGAAGGTACTAGATTCAGGGAGCAGCCATGCCCAGCTCTGCACTTGATCCTCAGTCTGAATACTTCAAAGTGGTCCTCTAGGTTGTGT

GAGTTACAGACCAAAGAGAGACCCCCATGGTTAGCAAGAACTTGATGCCAGCCACAGTTCATACTTGCTTTGAATTTTGGCTCTAATGTCAGTCCCAGAG

AAGCATCCTTTTTCTTTAGGTGGCAATATATGTATTTATTTTTTGTAAGTTAATACCATTCTTTCACTTTAAAGGGCCCAGATTTCTCCTGAGAGTCTTT

TTGTAATGACACTGGAAACATGACTATTTGAAAATAATTTGCAGTAAAGAAAAATATTTCATTTCTTTCT
Translation
MALRSFCSADGSDPLW - UNI24559 - DWNVTWHTSNPDFTKCFQNTVLTWVPCFYLWSCFPLYFFYLSRHDRGYIQMTHLNKTKT ALGFFLWIIC

WADLFYSFWERSQGVLRAPVLLVSPTLLGITM LLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKK DAHVDVFRDSTFYLYFTLVL

VQLVLSCFSDCSPLFSETVHDR NPCPESSASFLSRITFWWITG GMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRK KQPVRIVYA

PPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILE ELIINFVNDREAPDWQGYFYTALLFVSAC

LQTLALHQYFHICFVSGMRIKTAVVGAVYRK ALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWL SLGPSVLAGVAVM

ILMVPLNAVMAMKTKTYQ VAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFL VALSTFAVFVTV

DERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQ ASVSLKRLRIFLSHEELEPDSIERRSIKSG GEGNSITVKNATFTWARGEPPTLNG GITFS

IPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLK GSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEK G

VNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNK TRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAE

FLRTYANAEQDLASEDDS SVSGSGKESKPVENGMLVTDTVGKHLQR RHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQ VQLSVY

WNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQANRNFRLSVYGALGILQG GAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSP

MSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQ RFYVASSRQLKRLESVSRSPVYSHFNETL

LGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANR RWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQ ITAYLNWLVRMSSEMET

NIVAVERLKEYSETEKE APWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEK VGIVGRTGAGKSSLTLGLFRINESAEGEIIID

GVNIAKIGLHNLRFKITIIPQ DPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLS SVGQRQLVCLARALLRKTKIL

VLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTR RVIVLDKGEVRECGAPSELLQQRGIFYSMAKDAGLV

For any suggestions or comments, please send an email to unitrap@crg.es