Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023191 (Leprel2)
Chromosomal location
Chr 6: 124791113 - 124807705 (-)
Description
leprecan-like 2 Gene [Source:MGI Symbol;Acc:MGI:1315208]
Human Ortholog
not available
Omim not available
UniTrap UNI36159
Vector Insertion
Chr 6: 124795959 - 124800769
Public Clones IST14194F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36198
Vector Insertion
Chr 6: 124792089 - 124795110
Public Clones IST13765C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023958
Sequence
ATGCTCCGGCTCCTGCGGTTGTTGCTTTTGCTGCTGCTGCCTCCCCCGGGGTCCCCCGAGCCTCCCGAGCCCCCGGGCCTGGCTCAGTTGTCACCGGGGT

CGCCTCCCCAGGCCCCCGACTTGCTCTACGCGGACGGGCTGCGAGCCTACTCGGCCGGGGCTTGGGCGCCCGCAGTGGCGCTGCTGCGAGAGGCGCTGCG

GAGCCGGGCGGCGCTGGGCCGCGCGCGCCAGGAGTGCGGGGCGAGCTGCGCGGCCGAGCCGGGCGCCGCGCTCCCCTCCCAGCTCCTCGGAGCCCCACAT

CCTGTCTCCGGGCCCGGGGTCTGGGAACCGCTGCTCCTGCGCGCCACGCTCCGCCGCGCCGAGTGCCTGACCCAGTGCGCGGTGCGGAGGCTGGGCCCGG

GGGGCGCGGCGCGGCTCCGCGTGGGGAGCGCGCTGCGGGATGCCTTCCGCCGGCGGGAGCCTTACAACTACCTGCAGAGGGCCTACTACCAG TTGAAGA

AGCTGGACCTGGCAGCTTCTGCAGCACACACCTTCTTTGTGGCAAACCCAACACACCTGCAGATGCGGGAAGACATGGCTAAGTACAGAAGGATGTCTGC

AATCCGACCCCAGAGCTTCCGGGACCTGGTGACGCCCCTATACTGG GCAGCTTATGACACTGGCCTGGAGCTTCTGGAGCAACGGGAGGCAGCACTGGC

TCTACCCCAACTAGAGGAGGCCCTGCAGGGGAGCCTGGCCCACATGGAGAGCTGCCGTGCTGCCTGTGAGGGGCCTGAGGAGCACCAAGGGGCTGAAGAA

GAGGGAGAAGGGAGCCAGGGAGGCCTGTATGAAGCCATTGCAG GACACTGGATACGGGTTCTGCAGTGCAGGCAGCACTGTGTGGCAGACACGGCCACC

CGTCCTGGTCGCAGCTTCCCTGTCCAGGACTTCCTCCTCAGCCAGCTGAGACGGCTGCACGAGGCGTATGCTCAGG TGGGGAACATGTCTCAGGCCATG

GAAAATGTCCTGAGTGTCCTGCTCTTCTACCCAGAGGATGAGGCTGCCAAAAAGGCTCTGAACCAGTACCAAACTCAGTTGGGAGAGCCAAGACCTGACC

TGGGACCACGAGAG GACATCCAGCGGTTCATCCTTCGCTCCCTCGGAGAGAAGAGACAGTTATATTACGCCATGGAGCATCTGGGCACTAGCTTCAAGG

ACCCG GATTCTTGGACCCCGGAGGCTCTCATCCCTAAGGCACTGAGAGAGAGGCTCAG AGAGGATCAAGAGAAGAAGCCCTGGGACCATCAGCCTCCA

CAGCAGAAGCCCTTGGCTCACTGGAAGG - UNI36159 - ATGCCCTTCTGATGGAGGGTGTGACCCTCACGCAGGACGCCCAGCAGCTGAATGGGTC

GGAGCGAGCTGTCTTAGATGGGCTGCTAACTTCAGCCGAGTGTGGGGTTCTGCTGCAGCTGGCCAAG - UNI36159 - GATGCAGCACAGGCTGGAG

CCAGGTCAGGCTACCGTGGCCGCCGCTCTCCTCATAGTCCTCATGAACGCTTTGAGGGGCTCACGGTGCTCAAGGCTGCTCAG - UNI36159 - CTG

GCCCGGGCAGGGACTGTGGGCAGGCCAGGCGCTAAGCTGCTTCTGGAGGTAAGTGAGCGAGTGCGGACTTTGACCCAGGCCTACTTCTCCCCGGAACGGC

CACTGCATCTTTCCTTCACCCACCTGGTGTGCCGAAGTGCCATAGAAG GTGAACAAGAGCAGCGTATGGACCTGAGTCACCCGGTTCATGCAGACAACT

GTGTCCTGGACCCCGACACTGGCGAATGCTGGCGGGAGCCCCCAGCCTACACCTATCGAGACTATAG - UNI36198 - TGGACTCCTCTACCTCAAT

GATGACTTCAAGGGAGGCGACCTGTTCTTCACGCAGCCCAACGCCCTCACTGTCACG - UNI36198 - GCTCAGGTCCGTCCTCGGTGTGGGCGCCT

TGTGGCCTTCAGCTCTGGTGGTGAGAATCCCCATGGTGTATGGGCTGTGACTCGGGGACGGCGCTGTGCCCTAGCACTGTGGCACACGTGGGCACCTGAG

CACAGTGAACAG - UNI36198 - GAGTGGACAGAAGCCAAAGAGCTGCTGCAGGAGGAAGAGGAGGAAGAAGAGGAGGAAGACATTCTCAGCAGAGA

CCCTTCCCCAGAACCCCCAAGTCACAAGCTTCAGCGAGTCCAGGAGAAAGCTGGGAAGCCCCGCCGGGTCCGGGTCCGAGAGGAACTGTGAATGGCTGAG

CCTGCTTCTCAGGATCAGGCCACTCAACTTGGGAAGGAACTGATGAGAAGGCTCTGGAGGATATCAGGAACATAGTAGCATGCCAAGTCTACCATCTCGG

GGACTTACAAGGGCTACCAGACCCTGGACTCACAAGCTTGCTACACAGACTTAGCCTACAGCACATCAGGCCCGGGAGCCAGGTCTGGCCCCAGCTGAGG

GACCTGCAAGGTCCCCAGGACAGACAAAAATCACTATGCCTCCCTGAAAGGCAGGCATGTGGAGGAGTGCAGAGCAACTGCTTCTAATAAGAAACACACA

GAGGGGCTGGAGAGATGGCTCAGCGGTTAAGAGCACTGACTGCTCTTCTGAGGTCCAGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCCG

TAATGAGATCTGGCGCCCTCTTCTGGGGCGTCTGAGGACAGCAACAGTGTACTTACATATAATAAATAAATAAATCTTTAAAAAAAGAAAAAGAAAAGAA

AAGAAACACACAGAGGAGACAGTCCCATCCTCTCCCAACCTGTGCAATAAATAATGATCATGAGGCTCTCC
Translation
MLRLLRLLLLLLLPPPGSPEPPEPPGLAQLSPGSPPQAPDLLYADGLRAYSAGAWAPAVALLREALRSRAALGRARQECGASCAAEPGAALPSQLLGAPH

PVSGPGVWEPLLLRATLRRAECLTQCAVRRLGPGGAARLRVGSALRDAFRRREPYNYLQRAYYQ LKKLDLAASAAHTFFVANPTHLQMREDMAKYRRMS

AIRPQSFRDLVTPLYW AAYDTGLELLEQREAALALPQLEEALQGSLAHMESCRAACEGPEEHQGAEEEGEGSQGGLYEAIAG GHWIRVLQCRQHCVAD

TATRPGRSFPVQDFLLSQLRRLHEAYAQV VGNMSQAMENVLSVLLFYPEDEAAKKALNQYQTQLGEPRPDLGPRE DIQRFILRSLGEKRQLYYAMEHL

GTSFKDP DSWTPEALIPKALRERLR REDQEKKPWDHQPPQQKPLAHWKD - UNI36159 - DALLMEGVTLTQDAQQLNGSERAVLDGLLTSAECG

VLLQLAK - UNI36159 - DAAQAGARSGYRGRRSPHSPHERFEGLTVLKAAQ - UNI36159 - LARAGTVGRPGAKLLLEVSERVRTLTQAYFS

PERPLHLSFTHLVCRSAIEG GEQEQRMDLSHPVHADNCVLDPDTGECWREPPAYTYRDYS - UNI36198 - SGLLYLNDDFKGGDLFFTQPNALTV

T - UNI36198 - AQVRPRCGRLVAFSSGGENPHGVWAVTRGRRCALALWHTWAPEHSEQ - UNI36198 - EWTEAKELLQEEEEEEEEEDILSR

DPSPEPPSHKLQRVQEKAGKPRRVRVREEL

For any suggestions or comments, please send an email to unitrap@crg.es