Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023272 (Creld2)
Chromosomal location
Chr 15: 88650076 - 88657111 (+)
Description
cysteine-rich with EGF-like domains 2 Gene [Source:MGI Symbol;Acc:MGI:1923987]
RefSeq_dna
NM_029720 
RefSeq_peptide
NP_083996.1 
UniGene
Mm.292567 
MGI
MGI:1923987 
Uniprot/SWISSPROT
Q9CYA0 
Human Ortholog
ENSG00000184164 (CRELD2)
Omim not available
UniTrap UNI11687
Vector Insertion
Chr 15: 88650265 - 88650360
Public Clones P080C08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024042
Sequence
GGGCCGGTGGGCGGAGGCTCAGACTCCGCCGCAGTTCTCGGTGGGTCGCCGGGCAGCCCTCCCGCCATGCACCTGCTGCTTGCAGCCGCGTTCGGGCTGC

TGCTGCTGCTGCCGCCGCCCGGGGCCGTAGCCTCCCGGAAGCCGACGATGTGCCAGAGATGCCGGACGCTGGTGGACAAGTTCAACCAG - UNI11687

 - GGGATGGCCAACACGGCCAGGAAGAATTTCGGTGGCGGCAACACGGCGTGGGAAGAGAAGACGCTGTCTAAGTACGAATTCAG TGAGATCCGGCTT

CTGGAGATCATGGAGGGTCTGTGTGACAGCAGTGACTTTGAGTGCAACCAACTCTTGGAGCAGCAGGAGGAGCAGCTAGAGGCTTGGTGGCAGACACT G

AAGAAGGAGCACCCCAACCTATTTGAGTGGTTCTGTGTACACACACTGAAAGCGTGCTGTCTTCCAGGCACCTACGGGCCAGACTGTCAAG AGTGCCAG

GGTGGGTCCGAGAGGCCTTGCAGCGGAAACGGCTATTGCAGCGGAGACGGCAGCAGACAGGGCGACGGGTCCTGCCAGTGTCACACAGGCTACAAGGGAC

CACTGTGTATTGACTGCACAGACGGCTTCTTCAGCTTGCAGAGGAACGAGACCCACAGCATCTGCTCAG CCTGTGATGAGTCTTGCAAGACCTGCTCTG

GTCCAAGCAACAAAGACTGTATCCAGTGTGAAGTGGGCTGGGCACGTGTGGAGGATGCCTGTGTGG ATGTGGATGAGTGTGCAGCAGAGACATCTCCGT

GCAGCGATGGCCAGTACTGTGAGAATGTCAACGGCTCGTACACATGTGAAG ACTGTGATTCTACCTGCGTGGGCTGTACAGGAAAAGGCCCAGCCAACT

GTAAGGAGTGTATTGCCGGCTACACCAAGGAGAGTGGACAGTGCACAG ATATAGATGAATGCTCACTAGAAGAAAAAGCCTGTAAGAGGAAAAACGAAA

ACTGCTACAATGTTCCGGGGAGCTTCGTGTGCGTGTGTCCGGAAGGCTTTGAGGAGACAGAAGACGCTTGTGTGCAGACAGCAGAAGGCA AAGTCACAG

AGGAAAACCCCACACAGCCACCCTCCCGTGAGGATTTGTGACGGGCATCCGGATTCAGAAGCCAAACTCACCCTTTAAGTTATTGAGAGGATACCTATAG

AAAATGTGGCCCATGGACATGAACCCCATTTCTCCAGGAAGACTTCAGAGGGAGAAGCTGCGTACTCGGACACAGCTGATGCTCACTTGGCCCTTTCAAA

AGCTGCATTTCTTGGTGGTTCTTACACAGATTTGTATATTTTGATATTGTTCTTTATAATAAAAATGATCATTGAAGGTCACCAGG
Translation
MHLLLAAAFGLLLLLPPPGAVASRKPTMCQRCRTLVDKFNQ - UNI11687 - GMANTARKNFGGGNTAWEEKTLSKYEFS SEIRLLEIMEGLCDSS

DFECNQLLEQQEEQLEAWWQTL LKKEHPNLFEWFCVHTLKACCLPGTYGPDCQE ECQGGSERPCSGNGYCSGDGSRQGDGSCQCHTGYKGPLCIDCTD

GFFSLQRNETHSICSA ACDESCKTCSGPSNKDCIQCEVGWARVEDACVD DVDECAAETSPCSDGQYCENVNGSYTCED DCDSTCVGCTGKGPANCKE

CIAGYTKESGQCTD DIDECSLEEKACKRKNENCYNVPGSFVCVCPEGFEETEDACVQTAEGK KVTEENPTQPPSREDL

For any suggestions or comments, please send an email to unitrap@crg.es