Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023345 (Wdr51a)
Chromosomal location
Chr 9: 106183643 - 106252202 (+)
Description
WD repeat domain 51A Gene [Source:MGI Symbol;Acc:MGI:1917485]
RefSeq_dna
NM_027354 
RefSeq_peptide
NP_081630.1 
UniGene
Mm.23054 
MGI
MGI:1917485 
Uniprot/SWISSPROT
Q8JZX3 
Uniprot/SPTREMBL
Q8BJN7 
Human Ortholog
ENSG00000164087 (WDR51A)
Omim not available
UniTrap UNI2328
Vector Insertion
Chr 9: 106183788 - 106185182
Public Clones AC0252 (sanger) AE0190 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5140
Vector Insertion
Chr 9: 106187904 - 106189110
Public Clones YTC349 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4141
Vector Insertion
Chr 9: 106207665 - 106210271
Public Clones AN0232 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27096
Vector Insertion
Chr 9: 106210365 - 106232203
Public Clones 5SE289G02 (ggtc)
Private Clones OST71164 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1421
Vector Insertion
Chr 9: 106232348 - 106252012
Public Clones CH0169 (sanger) CMHD-GT_356B12-3 (cmhd) CMHD-GT_540G8-3 (cmhd) CMHD-GT_363E4-3 (cmhd)
CMHD-GT_497A4-3 (cmhd) CMHD-GT_540F8-3 (cmhd) CMHD-GT_169D4-3 (cmhd) CMHD-GT_540G8-5S (cmhd)
CMHD-GT_540H8-3 (cmhd) CMHD-GT_158F6-3 (cmhd) CMHD-GT_515A1-3 (cmhd) CMHD-GT_479D9-3 (cmhd)
IST12301G7 (tigm)
Private Clones OST452450 (lexicon) OST452446 (lexicon) OST373356 (lexicon) OST90962 (lexicon)
OST60487 (lexicon) OST44436 (lexicon) OST44384 (lexicon) OST43119 (lexicon)
OST31682 (lexicon) OST29933 (lexicon) OST29791 (lexicon) OST29747 (lexicon)
OST29723 (lexicon) OST29494 (lexicon) OST28456 (lexicon) OST26445 (lexicon)
OST26292 (lexicon) OST25275 (lexicon) OST24511 (lexicon) OST24038 (lexicon)
OST23557 (lexicon) OST21552 (lexicon) OST20964 (lexicon) OST20619 (lexicon)
OST19893 (lexicon) OST18372 (lexicon) OST18160 (lexicon) OST18107 (lexicon)
OST18055 (lexicon) OST17749 (lexicon) OST17362 (lexicon) OST16899 (lexicon)
OST16761 (lexicon) OST16672 (lexicon) OST15543 (lexicon) OST15414 (lexicon)
OST15051 (lexicon) OST14650 (lexicon) OST14628 (lexicon) OST14511 (lexicon)
OST13871 (lexicon) OST13274 (lexicon) OST13235 (lexicon) OST13183 (lexicon)
OST12970 (lexicon) OST11746 (lexicon) OST11650 (lexicon) OST11114 (lexicon)
OST9927 (lexicon) OST8192 (lexicon) OST7263 (lexicon) OST7065 (lexicon)
OST2528 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024116
Sequence
ATGTGCAGGTCCATGATCCAGGCACAGGCCTGGGTGACCAGCAAGGCGTGGCCACTCCCTGCTTCACCTGCAG TACACAGTGCAGCCGTGAATGCCCTC

TCCTTCCACCCATCGGGAAACTACCTCATCACAGCCTCCAGTGACTCAACGCTGAAGATCCTGGACCTGATGGAGGGCCGGCTGCTCTATACGCTCCATG

GGCACCAG GGGCCTGCTACCACCGTTGCCTTTTCAAGAACGGGGGAGTATTTCGCTTCTGGAGGCTCCGATGAGCAG - UNI4141 - GTGATGGTC

TGGAAGAGTAACTTTGACATTGTTGATTATGGAGACATGAAGGCACGGAGGCCCCCACCCCTAACCAGCTCTTCTGGAACTCTG - UNI27096 - CC

AAAAATGGATTTGCCTGTCCCACCAGGCAGAGACAGGAGTCTGGAGTCAGTTCAAGGCGAGCCCCAGGAGTCCATCAGCATGCCTCAGACACTGACCAGC

ACCCTGGAGCACATCGTGGGCCAGCTGGACATCCTCACGCAG - UNI1421 - ACAGTGTCCATTCTGGAACAGCGACTGACACTAACAGAAGACAGG

CTGAAGCAGTGCCTGGAGAACCAGCAGCTAATCATGCAGAGAACGCCACCGTGATGAGGGGAGCAAGGATCAGGAGCTCAGTGATTGGGGGGACAGCAGG

CCAGGGATTTGTATGGGGACTTGAGTAAATAAATAAAGGGATCCC
Translation
MCRSMIQAQAWVTSKAWPLPASPAV VHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQ GPATTVAFSRTGEYFASGGSDEQ - UN

I4141 - VMVWKSNFDIVDYGDMKARRPPPLTSSSGTL - UNI27096 - PKMDLPVPPGRDRSLESVQGEPQESISMPQTLTSTLEHIVGQLDILT

Q - UNI1421 - TVSILEQRLTLTEDRLKQCLENQQLIMQRTPP
Transcript ENSMUST00000068577
Sequence
GCGGCGACGCCACCGGCGTTGCTATTGGTGGCGATTGGGGGCGCGGAAACTGAACTGGCACAACTGCCGACCCAGCTATCTCTGGCACTTGGGGCACAGC

TGGTCCTACCAGCCCGCTAGCCCCGCTATGGCTGCTCCCAGCCAG - UNI2328 - GAGGACCCCTCACTGGAGAGACATTTTAAGGGCCACCGAGAT

GCAGTCACCTGTGTGGACTTCAGTCTCAACACCAAGCACTTGG CCAGTGGCTCCATGGACTCAACCCTCATGATCTGGCACATGAAGCCCCAGTCACGT

GCCTACCGCTTCACGGGCCACAAGGACGCTGTGACCTGTGTGAATTTCTCCCCATCGGGACACCTTCTTGCCTCAGGCTCCCGAGACAAGACTGTTCGCA

TCTGGGTACCCAATGT CAAAGGTGAGTCAACTGTATTTCGTGCACACACGGCCACAGTGAGGAGTGTCCACTTCTGCAGCGATGGCCAGTCACTTGTGA

CAGCCTCTGATGACAAGACAGTCAAAGTGTGGTCAACTCATCGCCAGAGATTCCTGTTTTCCCTGACCCAGCACATCAACTGGGTCCGCTGTGCCAA - 

UNI5140 - GTTCTCCCCTGACGGGCGGCTCATCGTGTCTGCCAGTGATGACAAGACTGTCAAGCTGTGGGACAAGACCAGCCGGGAATGTATCCACTC

ATACTGTGAGCACGGCGG TTTTGTCACCTACGTGGACTTCCACCCCAGTGGTACCTGCATTGCTGCTGCCGGCATGGACAACACGGTGAAGGTGTGGGA

TGCGCGGACTCATCGGCTGTTGCAGCATTATCAGT TACACAGTGCAGCCGTGAATGCCCTCTCCTTCCACCCATCGGGAAACTACCTCATCACAGCCTC

CAGTGACTCAACGCTGAAGATCCTGGACCTGATGGAGGGCCGGCTGCTCTATACGCTCCATGGGCACCAG GGGCCTGCTACCACCGTTGCCTTTTCAAG

AACGGGGGAGTATTTCGCTTCTGGAGGCTCCGATGAGCAG - UNI4141 - GTGATGGTCTGGAAGAGTAACTTTGACATTGTTGATTATGGAGACAT

GAAGGCACGGAGGCCCCCACCCCTAACCAGCTCTTCTGGAACTCTG - UNI1421 - - UNI27096 - ACAGTGTCCATTCTGGAACAGCGACTGA

CACTAACAGAAGACAGGCTGAAGCAGTGCCTGGAGAACCAGCAGCTAATCATGCAGAGAACGCCACCGTGATGAGGGGAGCAAGGATCAGGAGCTCAGTG

ATTGGGGGGACAGCAGGCCAGGGATTTGTATGGGGACTTGAGTAAATAAATAAAGGGATCCC
Translation
MAAPSQ - UNI2328 - EDPSLERHFKGHRDAVTCVDFSLNTKHLA ASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTV

RIWVPNV VKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAK - UNI5140 - KFSPDGRLIVSASDDKTV

KLWDKTSRECIHSYCEHGG GFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQL LHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLY

TLHGHQ GPATTVAFSRTGEYFASGGSDEQ - UNI4141 - VMVWKSNFDIVDYGDMKARRPPPLTSSSGTL - UNI1421 - - UNI27096 - 

TVSILEQRLTLTEDRLKQCLENQQLIMQRTPP
Transcript ENSMUST00000072206
Sequence
GCGGCGACGCCACCGGCGTTGCTATTGGTGGCGATTGGGGGCGCGGAAACTGAACTGGCACAACTGCCGACCCAGCTATCTCTGGCACTTGGGGCACAGC

TGGTCCTACCAGCCCGCTAGCCCCGCTATGGCTGCTCCCAGCCAG - UNI2328 - GAGGACCCCTCACTGGAGAGACATTTTAAGGGCCACCGAGAT

GCAGTCACCTGTGTGGACTTCAGTCTCAACACCAAGCACTTGG CCAGTGGCTCCATGGACTCAACCCTCATGATCTGGCACATGAAGCCCCAGTCACGT

GCCTACCGCTTCACGGGCCACAAGGACGCTGTGACCTGTGTGAATTTCTCCCCATCGGGACACCTTCTTGCCTCAGGCTCCCGAGACAAGACTGTTCGCA

TCTGGGTACCCAATGT CAAAGGTGAGTCAACTGTATTTCGTGCACACACGGCCACAGTGAGGAGTGTCCACTTCTGCAGCGATGGCCAGTCACTTGTGA

CAGCCTCTGATGACAAGACAGTCAAAGTGTGGTCAACTCATCGCCAGAGATTCCTGTTTTCCCTGACCCAGCACATCAACTGGGTCCGCTGTGCCAA - 

UNI5140 - GTTCTCCCCTGACGGGCGGCTCATCGTGTCTGCCAGTGATGACAAGACTGTCAAGCTGTGGGACAAGACCAGCCGGGAATGTATCCACTC

ATACTGTGAGCACGGCGG TTTTGTCACCTACGTGGACTTCCACCCCAGTGGTACCTGCATTGCTGCTGCCGGCATGGACAACACGGTGAAGGTGTGGGA

TGCGCGGACTCATCGGCTGTTGCAGCATTATCAGT TACACAGTGCAGCCGTGAATGCCCTCTCCTTCCACCCATCGGGAAACTACCTCATCACAGCCTC

CAGTGACTCAACGCTGAAGATCCTGGACCTGATGGAGGGCCGGCTGCTCTATACGCTCCATGGGCACCAG GGGCCTGCTACCACCGTTGCCTTTTCAAG

AACGGGGGAGTATTTCGCTTCTGGAGGCTCCGATGAGCAG - UNI4141 - GTGATGGTCTGGAAGAGTAACTTTGACATTGTTGATTATGGAGACAT

GAAGGCACGGAGGCCCCCACCCCTAACCAGCTCTTCTGGAACTCTG - UNI27096 - CCAAAAATGGATTTGCCTGTCCCACCAGGCAGAGACAGGA

GTCTGGAGTCAGTTCAAGGCGAGCCCCAGGAGTCCATCAGCATGCCTCAGACACTGACCAGCACCCTGGAGCACATCGTGGGCCAGCTGGACATCCTCAC

GCAG - UNI1421 - ACAGTGTCCATTCTGGAACAGCGACTGACACTAACAGAAGACAGGCTGAAGCAGTGCCTGGAGAACCAGCAGCTAATCATGCA

GAGAACGCCACCGTGATGAGGGGAGCAAGGATCAGGAGCTCAGTGATTGGGGGGACAGCAGGCCAGGGATTTGTATGGGGACTTGAGTAAATAAATAAAG

GGATCCC
Translation
MAAPSQ - UNI2328 - EDPSLERHFKGHRDAVTCVDFSLNTKHLA ASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTV

RIWVPNV VKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAK - UNI5140 - KFSPDGRLIVSASDDKTV

KLWDKTSRECIHSYCEHGG GFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQL LHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLY

TLHGHQ GPATTVAFSRTGEYFASGGSDEQ - UNI4141 - VMVWKSNFDIVDYGDMKARRPPPLTSSSGTL - UNI27096 - PKMDLPVPPGRD

RSLESVQGEPQESISMPQTLTSTLEHIVGQLDILTQ - UNI1421 - TVSILEQRLTLTEDRLKQCLENQQLIMQRTPP

For any suggestions or comments, please send an email to unitrap@crg.es