Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023764 (Sfi1)
Chromosomal location
Chr 11: 3031853 - 3093466 (-)
Description
Sfi1 homolog, spindle assembly associated (yeast) Gene [Source:MGI (curated);Acc:Sfi1-001]
RefSeq_dna
NM_030207 
RefSeq_peptide
NP_084483.2 
UniGene
Mm.404558 
MGI
MGI:1926137 
Uniprot/SWISSPROT
Q3UZY0 
Uniprot/SPTREMBL
A8Y5K5 Q5NC01 A8Y5K4 Q5NBZ9 
Human Ortholog
ENSG00000198089 (SFI1)
Omim not available
UniTrap UNI19346
Vector Insertion
Chr 11: 3087242 - 3087414
Public Clones not available
Private Clones OST393921 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32257
Vector Insertion
Chr 11: 3079399 - 3085978
Public Clones IST10922D6 (tigm) IST13882G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30633
Vector Insertion
Chr 11: 3070589 - 3077497
Public Clones IST12484H9BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30568
Vector Insertion
Chr 11: 3065578 - 3070708
Public Clones (sanger) IST12809D1 (tigm) IST13459H4 (tigm) IST13540H11 (tigm) IST13889E10 (tigm)
IST13037F9HMF1 (tigm) IST13377E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34418
Vector Insertion
Chr 11: 3059987 - 3064717
Public Clones IST11626H12 (tigm) IST14508H10 (tigm) IST13486D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33508
Vector Insertion
Chr 11: 3057868 - 3060150
Public Clones IST12550G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36648
Vector Insertion
Chr 11: 3055401 - 3056868
Public Clones IST13941H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32553
Vector Insertion
Chr 11: 3053434 - 3055500
Public Clones IST14671H6 (tigm) IST14430G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31688
Vector Insertion
Chr 11: 3046164 - 3053502
Public Clones IST12093G2 (tigm) IST14237F9 (tigm) IST10911E8 (tigm) IST10626E7 (tigm)
IST15105G11 (tigm) IST15005B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35423
Vector Insertion
Chr 11: 3040139 - 3042414
Public Clones IST12703H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33909
Vector Insertion
Chr 11: 3036948 - 3040237
Public Clones IST13879H11 (tigm) IST14396E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118627
Sequence
ACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCCTCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCA

ATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAATGGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCT

TTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTTCTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCT

GCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCGAATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTC

CTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32257 - GTGGTGATGGTGCGTACCTTTAATCCCAGCATT

TCAGAGGCAGAGGCAGTCAGATCTATGAGTTTGAAGACAGCCTGGTCTATAGAGCTAGTTCCAGGACAGCCAAAGCTACACAGAGAAACCCTGTTTCAAG

AAAAAAATTTTTTTTATTTGTTTTATGTATGTGAATACACTGTCTGTCTTCAGACACACCAGAAGAAGGCATCAGATGTGGTTGCTGGAGTTTGAACTCA

GGACCTTTGGAAGAGCAGTCGGTGCTCTTAACCACTGAGCCATCTCTCCAGCCATCCTCCCCAACCTGTTTTTAAAGACAGGGTCTTAACTTTGTAATTT

TAGTTGGGCTGGAACTCACTATGTAGAACAAGGCTGGACCCTAGCTCAGAATGTCAGGAATAAAGGTGTGCACC
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RW
Transcript ENSMUST00000101655
Sequence
ATGACAGCTGAGGTTAATGGCTCAA CTTGCTCAAATGTCAGGTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAA

AAGTCTTCTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAG

AACTTCGAATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG 

- UNI32257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTG

TGTCCGAGCTGACTGTCACTACAG - UNI32257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGA

TGAGGAAGAGGTTCCGAATAGCTGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTT

GATATACATGGTTTCTCGTAGGACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI306

33 - TTTCTGGTGGAGCAAGTGGAGGTGGCGACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCC

AGCTGCAG - UNI30568 - - UNI34418 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGC

TGTGCAACACTATCAGCACTGGCAGAAGCAGAGATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI31

688 - - UNI32554 - - UNI33508 - - UNI34418 - - UNI36648 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCA

CTGCCTGCTGCCTTCTACACGTGGTACAGAGGCTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688

 - AGGGACATTAGAGAAGCAAGTATTTGCTCTCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGC

AGAGCAGCAGCTTTTGCGTAGGTTCTGGTTCGTGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCAC

CACAGTGGACTGCTCAGGAGGGCTTTCTGCATCTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCAC

TCTGCACAGCTCTTGAGTCGGGCCTGGAGCATGTGGAGGGAG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAG

CACAACAGGCAGCTGCTGTG - UNI35423 - GTGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCA

AGCAAGAGTTCACTACAGCAGGACTCTGTGCTCCAAG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAG

ATATATTACCGACAAAAGGAGGCAGCTGCCCTCAGGGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGA

ACTGGTTTCAGCACTGGCGATTCTGCAGCCAGAGGGCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGA

AGCAATGGCCAGGTGGAAGGCACACCATCTGGGGTGTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGA

GACTCAGTCGGGCCTGCTTCTGCCAGTGGAGGAAGCAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCT

CACTACAAGCAAAG GTGTGGACTGCATGGCTGGGCTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGC

AGCTCCTACAG GAGGAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGCT

AAGGAGCTTGAGGCCCAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAGG

TGCTATCCTTCACAAGGCCTGGGACACCCTCAACAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAAT

GAAATGAATTACTGTT
Translation
MTAEVNGST TCSNVRSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVARKFLYLWIR

VTFGRVTPSRAR - UNI32257 - RIFHEQKILQKVFGEWREEWWVSQRE - UNI32257 -  - UNI30568 - - UNI30633 -  - UNI3

0568 - - UNI30633 -  - UNI30568 - - UNI34418 -  - UNI31688 - - UNI32554 - - UNI33508 - - UNI34418 - 

- UNI36648 -  - UNI31688 -     - UNI35423 -  - UNI33909 - - UNI35423 -  - UNI33909 - - UNI35423 -  -

 UNI33909 -     
Transcript ENSMUST00000093406
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAAGAGGTTCCGAATAGCTGAGCATCAT

G - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATACATGGTTTCTCGTAGGACCAAACTTC

ACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - TTTCTGGTGGAGCAAGTGGAGGTGGCG

ACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCCAGCTGCAG - UNI30568 - - UNI34418

 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGCTGTGCAACACTATCAGCACTGGCAGAAGCAGA

GATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI33508 - - UNI34418 - AGATGGCTGTACA

ATTCCACCGTGCTACTGTGCTCCAGATACATTTCTGTGACTGGCAGTGGGCCTGGGAGTGGAGGCAGAGCTTGTCTGCCCACCAGGCCCTGGTGGTGAAG

CTGGCCGGGAGGATGGTCCTGCGGAGGGCCTTTACACACTGGAAGCACT - UNI33508 - - UNI34418 - ACATGTTGCTACAGGCAGAAGAGG

CTGCCCAGCGCGAGGCAGCAGCTGAACACCGCCAGCACTACCTGCTG - UNI33508 - - UNI36648 - TATTCTTGCTTTAGAGCCTTCAAAGA

CAACGTGACCCAGGCCCGACTACAGCAAACAAGAAAGAAGCTTGCTCAGCAGCTGCGTGACACTACA - UNI32554 - - UNI36648 - TTGCTT

CACAGGTTCTGGAACCTCTGGCAGTCTCGAATTGAGCAGAGGGAGGAGAGGGTACAGACCCCCTCATTGCATGCAGCCCTGAGCCACTACAG - UNI31

688 - - UNI32554 - - UNI36648 - GGTGACAGTCCTACACAAGTGTGTCAGGGTGTGGCTACGGTATGTGCACAAGAGACAATGGCAGCAG 

- UNI31688 - - UNI32554 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCACTGCCTGCTGCCTTCTACACGTGGTACAGAGG

CTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688 - AGGGACATTAGAGAAGCAAGTATTTGCTC

TCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGCAGAGCAGCAGCTTTTGCGTAGGTTCTGGTTCG

TGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCACCACAGTGGACTGCTCAGGAGGGCTTTCTGCAT

CTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCACTCTGCACAGCTCTTGAGTCGGGCCTGGAGCAT

GTGGAGGGAG TGCCTGGCCCTGAGGCTGGAAGAGCAGCAGAAACTGAAGTGTGCGGCCCTGCACAGCCAGTGCATCCTGCTTCGCAGGGCTCTGCAGAA

GTGGCTG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAGCACAACAGGCAGCTGCTGTG - UNI35423 - G

TGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCAAGCAAGAGTTCACTACAGCAGGACTCTGTGCTCCA

AG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAGATATATTACCGACAAAAGGAGGCAGCTGCCCTCAG

GGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGAACTGGTTTCAGCACTGGCGATTCTGCAGCCAGAGG

GCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGAAGCAATGGCCAGGTGGAAGGCACACCATCTGGGGT

GTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGAGACTCAGTCGGGCCTGCTTCTGCCAGTGGAGGAAG

CAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCTCACTACAAGCAAAG GTGTGGACTGCATGGCTGGG

CTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGCAGCTCCTACAGGAGGGTGCCACACGGCTTCTGCGC

TTCACAGCTGGTACGAAGGCCTTCCGGCAGCAGCTCCAGGCCCAGCAGCAGGTCCAG GCAGCCCACAGCCTCCACTGTGCAGTCCGCCACTGTGCTGAG

CTCTGGAAAAAGAAGGTGCTTGGTCCAGGCAAGACTTCTCAACCACCAGCACCCACCACATTCAGCAAGAGAGTGACATTTAAGGATTCTTTCCTCTCTG

GACATGCTGCGGAGGCTGGAGATGCTACCCAGGAGACAAAGAAGCTTCGAGCTCCTCCATCTCAGGGAGTCCTGGGTAGTTTGGCAGGAGCTGCTGGGGA

GCCCTGCCACCTAGACCT CAATGCAGCCCGCTCATCACGGAAACAGCCCCGACGTCCATCCTTCCTGCTTGAGCGTTTGGGGAGTCAGAGGTCCCCAGA

GTGGTACAGCCTTGGGGAGCAGCA GTTAGAGAAGCCCCCAGAGGAGGAAAGCACGGCTCTGCTGGGAGGCTCTTCCCTGACAAGACCCTTCCTACCTGG

GGTCCTGCCGAATGTTCCTGGTCCGAAGCTGCCTCCTACGGCCAGTCCAGGCCTGGAGCTGCTGCCTCCCTCCTCCATCATGCCCCATGCGGCAGGAGGC

ACTGCTAGG GTGTCAGCGAAGCCCAGCATCCCTGGGCCTCAGCCTTGGGGGTGCCCGTCCTTACCCAGGGACCTTGATCCCCAACTCCTCCCTGGAGAT

TCCATAAGCACCCGGACTGAGCCTGTTTATGGCTCAGAGGCTACAG GCCACACAGAGCTTGAGGCTGAGTTGGAGGGGATCCAGCAGCAGTTACAACAC

TACCAAACCACCAAGCAGAACCTTTG GTCATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCTGGAGCTAAGCCAGGAGGAGCCGAAATCCGAGGAC

CTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGCTAAGGAGCTTGAGGCCCAGCGTCAGCCTGTTGGT

ACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAGGTGCTATCCTTCACAAGGCCTGGGACACCCTCAA

CAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAATGAAATGAATTACTGTTCAGAAGTCTCCTACTTT

TCATACAAAATACGGTACTACT
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RYYLYNLIFQNWKTFVHQQREMRKRFRIAEHHD - UNI30568 - - UNI30633 - DTKQKM

CQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLC - UNI30568 - - UNI30633 - CFWWSKWRWRLGQAHAEHA - UNI30568 - - UNI3

4418 -  - UNI33508 - - UNI34418 -  - UNI33508 - - UNI34418 -  - UNI33508 - - UNI36648 -  - UNI32554 

- - UNI36648 -  - UNI31688 - - UNI32554 - - UNI36648 -  - UNI31688 - - UNI32554 -  - UNI31688 -     

 - UNI35423 -  - UNI33909 - - UNI35423 -  - UNI33909 - - UNI35423 -  - UNI33909 -          
Transcript ENSMUST00000101649
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTGTGTCCGA

GCTGACTGTCACTACAG - UNI32257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAA

GAGGTTCCGAATAGCTGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATAC

ATGGTTTCTCGTAGGACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - TT

TCTGGTGGAGCAAGTGGAGGTGGCGACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCCAGCTGCA

G - UNI30568 - - UNI34418 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGCTGTGCAA

CACTATCAGCACTGGCAGAAGCAGAGATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI33508 - -

 UNI34418 - AGATGGCTGTACAATTCCACCGTGCTACTGTGCTCCAGATACATTTCTGTGACTGGCAGTGGGCCTGGGAGTGGAGGCAGAGCTTGTC

TGCCCACCAGGCCCTGGTGGTGAAGCTGGCCGGGAGGATGGTCCTGCGGAGGGCCTTTACACACTGGAAGCACT - UNI33508 - - UNI34418 -

 ACATGTTGCTACAGGCAGAAGAGGCTGCCCAGCGCGAGGCAGCAGCTGAACACCGCCAGCACTACCTGCTG - UNI32554 - - UNI33508 - -

 UNI36648 - TTGCTTCACAGGTTCTGGAACCTCTGGCAGTCTCGAATTGAGCAGAGGGAGGAGAGGGTACAGACCCCCTCATTGCATGCAGCCCTGA

GCCACTACAG - UNI31688 - - UNI32554 - - UNI36648 - GGTGACAGTCCTACACAAGTGTGTCAGGGTGTGGCTACGGTATGTGCACA

AGAGACAATGGCAGCAG - UNI31688 - - UNI32554 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCACTGCCTGCTGCCTT

CTACACGTGGTACAGAGGCTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688 - AGGGACATTAG

AGAAGCAAGTATTTGCTCTCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGCAGAGCAGCAGCTTT

TGCGTAGGTTCTGGTTCGTGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCACCACAGTGGACTGCT

CAGGAGGGCTTTCTGCATCTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCACTCTGCACAGCTCTT

GAGTCGGGCCTGGAGCATGTGGAGGGAG TGCCTGGCCCTGAGGCTGGAAGAGCAGCAGAAACTGAAGTGTGCGGCCCTGCACAGCCAGTGCATCCTGCT

TCGCAGGGCTCTGCAGAAGTGGCTG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAGCACAACAGGCAGCTGCT

GTG - UNI35423 - GTGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCAAGCAAGAGTTCACTACA

GCAGGACTCTGTGCTCCAAG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAGATATATTACCGACAAAA

GGAGGCAGCTGCCCTCAGGGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGAACTGGTTTCAGCACTGG

CGATTCTGCAGCCAGAGGGCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGAAGCAATGGCCAGGTGGA

AGGCACACCATCTGGGGTGTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGAGACTCAGTCGGGCCTGC

TTCTGCCAGTGGAGGAAGCAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCTCACTACAAGCAAAG GT

GTGGACTGCATGGCTGGGCTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGCAGCTCCTACAGGAGGGT

GCCACACGGCTTCTGCGCTTCACAGCTGGTACGAAGGCCTTCCGGCAGCAGCTCCAGGCCCAGCAGCAGGTCCAG GCAGCCCACAGCCTCCACTGTGCA

GTCCGCCACTGTGCTGAGCTCTGGAAAAAGAAGGTGCTTGGTCCAGGCAAGACTTCTCAACCACCAGCACCCACCACATTCAGCAAGAGAGTGACATTTA

AGGATTCTTTCCTCTCTGGACATGCTGCGGAGGCTGGAGATGCTACCCAGGAGACAAAGAAGCTTCGAGCTCCTCCATCTCAGGGAGTCCTGGGTAGTTT

GGCAGGAGCTGCTGGGGAGCCCTGCCACCTAGACCT CAATGCAGCCCGCTCATCACGGAAACAGCCCCGACGTCCATCCTTCCTGCTTGAGCGTTTGGG

GAGTCAGAGGTCCCCAGAGTGGTACAGCCTTGGGGAGCAGCA GTTAGAGAAGCCCCCAGAGGAGGAAAGCACGGCTCTGCTGGGAGGCTCTTCCCTGAC

AAGACCCTTCCTACCTGGGGTCCTGCCGAATGTTCCTGGTCCGAAGCTGCCTCCTACGGCCAGTCCAGGCCTGGAGCTGCTGCCTCCCTCCTCCATCATG

CCCCATGCGGCAGGAGGCACTGCTAGG GTGTCAGCGAAGCCCAGCATCCCTGGGCCTCAGCCTTGGGGGTGCCCGTCCTTACCCAGGGACCTTGATCCC

CAACTCCTCCCTGGAGATTCCATAAGCACCCGGACTGAGCCTGTTTATGGCTCAGAGGCTACAG GCCACACAGAGCTTGAGGCTGAGTTGGAGGGGATC

CAGCAGCAGTTACAACACTACCAAACCACCAAGCAGAACCTTTG GTCATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCTGGAGCTAAGCCAGGAG

GAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGCTAAGGAGCTTGAGGCC

CAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAGGTGCTATCCTTCACAA

GGCCTGGGACACCCTCAACAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAATGAAATGAATTACTGT

TCAGAAGTCTCCTACTTTTCATACAAAATACGGTACTACT
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RIFHEQKILQKVFGEWREEWWVSQREWKLCVRADCHYR - UNI32257 - RYYLYNLIFQNWKT

FVHQQREMRKRFRIAEHHD - UNI30568 - - UNI30633 - DTKQKMCQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLC - UNI30568 - 

- UNI30633 - CFWWSKWRWRLGQAHAEHALHAVAVKHRALSLQLQ - UNI30568 - - UNI34418 - GWLRWQEQLLISQRDRRKEATAVQH

YQHWQKQRSLKAWLKYLQICRVKRWQNE - UNI33508 - - UNI34418 - EMAVQFHRATVLQIHFCDWQWAWEWRQSLSAHQALVVKLAGRMVL

RRAFTHWKHY - UNI33508 - - UNI34418 - YMLLQAEEAAQREAAAEHRQHYLL - UNI32554 - - UNI33508 - - UNI36648 -

 LLHRFWNLWQSRIEQREERVQTPSLHAALSHYR - UNI31688 - - UNI32554 - - UNI36648 - RVTVLHKCVRVWLRYVHKRQWQQ - 

UNI31688 - - UNI32554 - LLRARADGHFQQRALPAAFYTWYRGWLWHQQRRILHTKAVRFHR - UNI31688 - RGTLEKQVFALWRQKMSQ

HRENCLAERM AILQAEQQLLRRFWFVWHQQAAVCQLERQQQAMAIAHHHSGLLRRAFCIWKESTQGFRIE ERMGRAQAAHFHSAQLLSRAWSMWRE C

LALRLEEQQKLKCAALHSQCILLRRALQKWL VYQNRVRSVLREVAARERQHNRQLLW - UNI35423 - WWALHLWRENTMARLDGAKKTSQARVHY

SRTLCSK - UNI33909 - - UNI35423 - VLVQWREVTSVQIYYRQKEAAALREARKALDRG - UNI33909 - - UNI35423 - GRLQNW

FQHWRFCSQRAAQQRFQLGQAAQHHHWQLLMEAMARWKAHHLGCIRKK - UNI33909 - FLQRQAAQLLAQRLSRACFCQWRKQ LAVRKQEQWGTA

RALWLWAFSLQAK VWTAWLGFVLERRRKKARLERAMQAYQQQLLQEGATRLLRFTAGTKAFRQQLQAQQQVQ AAHSLHCAVRHCAELWKKKVLGPGKT

SQPPAPTTFSKRVTFKDSFLSGHAAEAGDATQETKKLRAPPSQGVLGSLAGAAGEPCHLDL LNAARSSRKQPRRPSFLLERLGSQRSPEWYSLGEQQ Q

LEKPPEEESTALLGGSSLTRPFLPGVLPNVPGPKLPPTASPGLELLPPSSIMPHAAGGTAR    
Transcript ENSMUST00000072704
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTGTGTCCGA

GCTGACTGTCACTACAG - UNI30633 - - UNI32257 - AACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAAGAGGTTCCGAATAGC

TGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATACATGGTTTCTCGTAGG

ACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - TTTCTGGTGGAGCAAGT

GGAGGTGGCGACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCCAGCTGCAG - UNI30568 - 

- UNI34418 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGCTGTGCAACACTATCAGCACTGG

CAGAAGCAGAGATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI33508 - - UNI34418 - AGA

TGGCTGTACAATTCCACCGTGCTACTGTGCTCCAGATACATTTCTGTGACTGGCAGTGGGCCTGGGAGTGGAGGCAGAGCTTGTCTGCCCACCAGGCCCT

GGTGGTGAAGCTGGCCGGGAGGATGGTCCTGCGGAGGGCCTTTACACACTGGAAGCACT - UNI33508 - - UNI34418 - ACATGTTGCTACAG

GCAGAAGAGGCTGCCCAGCGCGAGGCAGCAGCTGAACACCGCCAGCACTACCTGCTGGTAAGAGCCTGG - UNI31688 - - UNI32554 - - UN

I33909 - - UNI35423 - - UNI36648 - GCTGAGTTGGAGGGGATCCAGCAGCAGTTACAACACTACCAAACCACCAAGCAGAACCTTTG GT

CATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCTGGAGCTAAGCCAGGAGGAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGA

ACTGGAGGAGGTAAGACCAGGTCAGCCCAGGGCCAGCCCCTGGCTGTCCTTCCTTTCAGCTTGCCTTGTCCCTCCCTCTCGCCCATGTCCCCAGGTGGAA

CTACAGGTCCAGCAGCTGGCTAAGGAGCTTGAGGCCCAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAG
Translation
  - UNI19346 -  - UNI19346 -  - UNI32257 - LSLQ - UNI30633 - - UNI32257 - NWKTFVHQQREMRKRFRIAEHHD - 

UNI30568 - - UNI30633 - DTKQKMCQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLC - UNI30568 - - UNI30633 - CFWWSKWRW

RLGQAHAEHALHAVAVKHRALSLQLQ - UNI30568 - - UNI34418 - GWLRWQEQLLISQRDRRKEATAVQHYQHWQKQRSLKAWLKYLQICRV

KRWQNE - UNI33508 - - UNI34418 - EMAVQFHRATVLQIHFCDWQWAWEWRQSLSAHQALVVKLAGRMVLRRAFTHWKHY - UNI33508 

- - UNI34418 - YMLLQAEEAAQREAAAEHRQHYLLVRAW - UNI31688 - - UNI32554 - - UNI33909 - - UNI35423 - - UN

I36648 - AELEGIQQQLQHYQTTKQNLW WSCQRQANSLRRWLELSQEEPKSEDLHLEEQVKTELEEVRPGQPRASPWLSFLSACLVPPSRPCPQVEL

QVQQLAKELEAQRQPVGTCIARVRALRRALC
Transcript ENSMUST00000093407
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTGTGTCCGA

GCTGACTGTCACTACAG - UNI32257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAA

GAGGTTCCGAATAGCTGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATAC

ATGGTTTCTCGTAGGACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - - 

UNI31688 - - UNI32554 - - UNI33508 - - UNI34418 - - UNI36648 - GGTGACAGTCCTACACAAGTGTGTCAGGGTGTGGCTA

CGGTATGTGCACAAGAGACAATGGCAGCAG - UNI31688 - - UNI32554 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCAC

TGCCTGCTGCCTTCTACACGTGGTACAGAGGCTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688 

- AGGGACATTAGAGAAGCAAGTATTTGCTCTCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGCA

GAGCAGCAGCTTTTGCGTAGGTTCTGGTTCGTGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCACC

ACAGTGGACTGCTCAGGAGGGCTTTCTGCATCTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCACT

CTGCACAGCTCTTGAGTCGGGCCTGGAGCATGTGGAGGGAG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAGC

ACAACAGGCAGCTGCTGTG - UNI35423 - GTGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCAA

GCAAGAGTTCACTACAGCAGGACTCTGTGCTCCAAG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAGA

TATATTACCGACAAAAGGAGGCAGCTGCCCTCAGGGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGAA

CTGGTTTCAGCACTGGCGATTCTGCAGCCAGAGGGCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGAA

GCAATGGCCAGGTGGAAGGCACACCATCTGGGGTGTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGAG

ACTCAGTCGGGCCTGCTTCTGCCAGTGGAGGAAGCAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCTC

ACTACAAGCAAAG GTGTGGACTGCATGGCTGGGCTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGCA

GCTCCTACAGGAGGGTGCCACACGGCTTCTGCGCTTCACAGCTGGTACGAAGGCCTTCCGGCAGCAGCTCCAGGCCCAGCAGCAGGTCCAG GCAGCCCA

CAGCCTCCACTGTGCAGTCCGCCACTGTGCTGAGCTCTGGAAAAAGAAGGTGCTTGGTCCAGGCAAGACTTCTCAACCACCAGCACCCACCACATTCAGC

AAGAGAGTGACATTTAAGGATTCTTTCCTCTCTGGACATGCTGCGGAGGCTGGAGATGCTACCCAGGAGACAAAGAAGCTTCGAGCTCCTCCATCTCAGG

GAGTCCTGGGTAGTTTGGCAGGAGCTGCTGGGGAGCCCTGCCACCTAGACCT CAATGCAGCCCGCTCATCACGGAAACAGCCCCGACGTCCATCCTTCC

TGCTTGAGCGTTTGGGGAGTCAGAGGTCCCCAGAGTGGTACAGCCTTGGGGAGCAGCA GTTAGAGAAGCCCCCAGAGGAGGAAAGCACGGCTCTGCTGG

GAGGCTCTTCCCTGACAAGACCCTTCCTACCTGGGGTCCTGCCGAATGTTCCTGGTCCGAAGCTGCCTCCTACGGCCAGTCCAGGCCTGGAGCTGCTGCC

TCCCTCCTCCATCATGCCCCATGCGGCAGGAGGCACTGCTAGG GTGTCAGCGAAGCCCAGCATCCCTGGGCCTCAGCCTTGGGGGTGCCCGTCCTTACC

CAGGGACCTTGATCCCCAACTCCTCCCTGGAGATTCCATAAGCACCCGGACTGAGCCTGTTTATGGCTCAGAGGCTACAG GCCACACAGAGCTTGAGGC

TGAGTTGGAGGGGATCCAGCAGCAGTTACAACACTACCAAACCACCAAGCAGAACCTTTG GTCATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCT

GGAGCTAAGCCAGGAGGAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGC

TAAGGAGCTTGAGGCCCAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAG

GTGCTATCCTTCACAAGGCCTGGGACACCCTCAACAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAA

TGAAATGAATTACTGTTCAGAAGTCTCCTACTTTTCATACAAAATACGGTACTACT
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RIFHEQKILQKVFGEWREEWWVSQREWKLCVRADCHYR - UNI32257 - RYYLYNLIFQNWKT

FVHQQREMRKRFRIAEHHD - UNI30568 - - UNI30633 - DTKQKMCQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLW - UNI30568 - 

- UNI30633 - - UNI31688 - - UNI32554 - - UNI33508 - - UNI34418 - - UNI36648 - WVTVLHKCVRVWLRYVHKRQWQ

Q - UNI31688 - - UNI32554 - LLRARADGHFQQRALPAAFYTWYRGWLWHQQRRILHTKAVRFHR - UNI31688 - RGTLEKQVFALWRQ

KMSQHRENCLAERM AILQAEQQLLRRFWFVWHQQAAVCQLERQQQAMAIAHHHSGLLRRAFCIWKESTQGFRIE ERMGRAQAAHFHSAQLLSRAWSMW

RE VYQNRVRSVLREVAARERQHNRQLLW - UNI35423 - WWALHLWRENTMARLDGAKKTSQARVHYSRTLCSK - UNI33909 - - UNI354

23 - VLVQWREVTSVQIYYRQKEAAALREARKALDRG - UNI33909 - - UNI35423 - GRLQNWFQHWRFCSQRAAQQRFQLGQAAQHHHWQL

LMEAMARWKAHHLGCIRKK - UNI33909 - FLQRQAAQLLAQRLSRACFCQWRKQ LAVRKQEQWGTARALWLWAFSLQAK VWTAWLGFVLERRRK

KARLERAMQAYQQQLLQEGATRLLRFTAGTKAFRQQLQAQQQVQ AAHSLHCAVRHCAELWKKKVLGPGKTSQPPAPTTFSKRVTFKDSFLSGHAAEAGD

ATQETKKLRAPPSQGVLGSLAGAAGEPCHLDL LNAARSSRKQPRRPSFLLERLGSQRSPEWYSLGEQQ QLEKPPEEESTALLGGSSLTRPFLPGVLPN

VPGPKLPPTASPGLELLPPSSIMPHAAGGTAR VSAKPSIPGPQPWGCPSLPRDLDPQLLPGDSISTRTEPVYGSEATG GHTELEAELEGIQQQLQHYQ

TTKQNLW WSCQRQANSLRRWLELSQEEPKSEDLHLEEQVKTELEE VELQVQQLAKELEAQRQPVGTCIARVRALRRALC
Transcript ENSMUST00000066391
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTGTGTCCGA

GCTGACTGTCACTACAG - UNI32257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAA

GAGGTTCCGAATAGCTGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATAC

ATGGTTTCTCGTAGGACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - TT

TCTGGTGGAGCAAGTGGAGGTGGCGACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCCAGCTGCA

G - UNI30568 - - UNI34418 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGCTGTGCAA

CACTATCAGCACTGGCAGAAGCAGAGATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI33508 - -

 UNI34418 - AGATGGCTGTACAATTCCACCGTGCTACTGTGCTCCAGATACATTTCTGTGACTGGCAGTGGGCCTGGGAGTGGAGGCAGAGCTTGTC

TGCCCACCAGGCCCTGGTGGTGAAGCTGGCCGGGAGGATGGTCCTGCGGAGGGCCTTTACACACTGGAAGCACT - UNI33508 - - UNI34418 -

 ACATGTTGCTACAGGCAGAAGAGGCTGCCCAGCGCGAGGCAGCAGCTGAACACCGCCAGCACTACCTGCTG - UNI33508 - - UNI36648 - T

ATTCTTGCTTTAGAGCCTTCAAAGACAACGTGACCCAGGCCCGACTACAGCAAACAAGAAAGAAGCTTGCTCAGCAGCTGCGTGACACTACA - UNI32

554 - - UNI36648 - TTGCTTCACAGGTTCTGGAACCTCTGGCAGTCTCGAATTGAGCAGAGGGAGGAGAGGGTACAGACCCCCTCATTGCATGCA

GCCCTGAGCCACTACAG - UNI31688 - - UNI32554 - - UNI36648 - GGTGACAGTCCTACACAAGTGTGTCAGGGTGTGGCTACGGTAT

GTGCACAAGAGACAATGGCAGCAG - UNI31688 - - UNI32554 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCACTGCCTG

CTGCCTTCTACACGTGGTACAGAGGCTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688 - AGGG

ACATTAGAGAAGCAAGTATTTGCTCTCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGCAGAGCAG

CAGCTTTTGCGTAGGTTCTGGTTCGTGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCACCACAGTG

GACTGCTCAGGAGGGCTTTCTGCATCTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCACTCTGCAC

AGCTCTTGAGTCGGGCCTGGAGCATGTGGAGGGAG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAGCACAACA

GGCAGCTGCTGTG - UNI35423 - GTGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCAAGCAAGA

GTTCACTACAGCAGGACTCTGTGCTCCAAG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAGATATATT

ACCGACAAAAGGAGGCAGCTGCCCTCAGGGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGAACTGGTT

TCAGCACTGGCGATTCTGCAGCCAGAGGGCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGAAGCAATG

GCCAGGTGGAAGGCACACCATCTGGGGTGTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGAGACTCAG

TCGGGCCTGCTTCTGCCAGTGGAGGAAGCAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCTCACTACA

AGCAAAG GTGTGGACTGCATGGCTGGGCTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGCAGCTCCT

ACAGGAGGGTGCCACACGGCTTCTGCGCTTCACAGCTGGTACGAAGGCCTTCCGGCAGCAGCTCCAGGCCCAGCAGCAGGTCCAG GCAGCCCACAGCCT

CCACTGTGCAGTCCGCCACTGTGCTGAGCTCTGGAAAAAGAAGGTGCTTGGTCCAGGCAAGACTTCTCAACCACCAGCACCCACCACATTCAGCAAGAGA

GTGACATTTAAGGATTCTTTCCTCTCTGGACATGCTGCGGAGGCTGGAGATGCTACCCAGGAGACAAAGAAGCTTCGAGCTCCTCCATCTCAGGGAGTCC

TGGGTAGTTTGGCAGGAGCTGCTGGGGAGCCCTGCCACCTAGACCT CAATGCAGCCCGCTCATCACGGAAACAGCCCCGACGTCCATCCTTCCTGCTTG

AGCGTTTGGGGAGTCAGAGGTCCCCAGAGTGGTACAGCCTTGGGGAGCAGCA GTTAGAGAAGCCCCCAGAGGAGGAAAGCACGGCTCTGCTGGGAGGCT

CTTCCCTGACAAGACCCTTCCTACCTGGGGTCCTGCCGAATGTTCCTGGTCCGAAGCTGCCTCCTACGGCCAGTCCAGGCCTGGAGCTGCTGCCTCCCTC

CTCCATCATGCCCCATGCGGCAGGAGGCACTGCTAGG GTGTCAGCGAAGCCCAGCATCCCTGGGCCTCAGCCTTGGGGGTGCCCGTCCTTACCCAGGGA

CCTTGATCCCCAACTCCTCCCTGGAGATTCCATAAGCACCCGGACTGAGCCTGTTTATGGCTCAGAGGCTACAG GCCACACAGAGCTTGAGGCTGAGTT

GGAGGGGATCCAGCAGCAGTTACAACACTACCAAACCACCAAGCAGAACCTTTG GTCATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCTGGAGCT

AAGCCAGGAGGAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGCTAAGGA

GCTTGAGGCCCAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAGGTGCTA

TCCTTCACAAGGCCTGGGACACCCTCAACAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAATGAAAT

GAATTACTGTTCAGAAGTCTCCTACTTTTCATACAAAATACGGTACTACT
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RIFHEQKILQKVFGEWREEWWVSQREWKLCVRADCHYR - UNI32257 - RYYLYNLIFQNWKT

FVHQQREMRKRFRIAEHHD - UNI30568 - - UNI30633 - DTKQKMCQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLC - UNI30568 - 

- UNI30633 - CFWWSKWRWRLGQAHAEHALHAVAVKHRALSLQLQ - UNI30568 - - UNI34418 - GWLRWQEQLLISQRDRRKEATAVQH

YQHWQKQRSLKAWLKYLQICRVKRWQNE - UNI33508 - - UNI34418 - EMAVQFHRATVLQIHFCDWQWAWEWRQSLSAHQALVVKLAGRMVL

RRAFTHWKHY - UNI33508 - - UNI34418 - YMLLQAEEAAQREAAAEHRQHYLL - UNI33508 - - UNI36648 - YSCFRAFKDNVT

QARLQQTRKKLAQQLRDTT - UNI32554 - - UNI36648 - LLHRFWNLWQSRIEQREERVQTPSLHAALSHYR - UNI31688 - - UNI32

554 - - UNI36648 - RVTVLHKCVRVWLRYVHKRQWQQ - UNI31688 - - UNI32554 - LLRARADGHFQQRALPAAFYTWYRGWLWHQQ

RRILHTKAVRFHR - UNI31688 - RGTLEKQVFALWRQKMSQHRENCLAERM AILQAEQQLLRRFWFVWHQQAAVCQLERQQQAMAIAHHHSGLLR

RAFCIWKESTQGFRIE ERMGRAQAAHFHSAQLLSRAWSMWRE VYQNRVRSVLREVAARERQHNRQLLW - UNI35423 - WWALHLWRENTMARLD

GAKKTSQARVHYSRTLCSK - UNI33909 - - UNI35423 - VLVQWREVTSVQIYYRQKEAAALREARKALDRG - UNI33909 - - UNI35

423 - GRLQNWFQHWRFCSQRAAQQRFQLGQAAQHHHWQLLMEAMARWKAHHLGCIRKK - UNI33909 - FLQRQAAQLLAQRLSRACFCQWRKQ 

LAVRKQEQWGTARALWLWAFSLQAK VWTAWLGFVLERRRKKARLERAMQAYQQQLLQEGATRLLRFTAGTKAFRQQLQAQQQVQ AAHSLHCAVRHCAE

LWKKKVLGPGKTSQPPAPTTFSKRVTFKDSFLSGHAAEAGDATQETKKLRAPPSQGVLGSLAGAAGEPCHLDL LNAARSSRKQPRRPSFLLERLGSQRS

PEWYSLGEQQ QLEKPPEEESTALLGGSSLTRPFLPGVLPNVPGPKLPPTASPGLELLPPSSIMPHAAGGTAR VSAKPSIPGPQPWGCPSLPRDLDPQL

LPGDSISTRTEPVYGSEATG GHTELEAELEGIQQQLQHYQTTKQNLW WSCQRQANSLRRWLELSQEEPKSEDLHLEEQVKTELEE VELQVQQLAKEL

EAQRQPVGTCIARVRALRRALC
Transcript ENSMUST00000081318
Sequence
GGAGACGGGGGAGGAGCCGCCGTCGGCGCAGGGCCGGAAACTCTGGGCTGGGGCCCTTTGCTACCACCTCTGTCTAGCGTCTGCTGAGGAGTCACCTCCC

TCAG TTATAAGAGGAAGTTAAAAGGCTTTGGTTCATCAATAACCTAGTCACAAAAATACATATCAACCACTGGTTGAATTTCCATCAAGAGGAAAGAAT

GGAGAAGAAGATTGGTTCCAG - UNI19346 - GTCTTTTAGGGATGGTGTGGTTAAGAAACCTTGTTCTCCAAAGACCCTGCCCCTCAAAAAGTCTT

CTGCCTTCTCTGGGATCCAGAGGGAGCCATCTAGAAGCTGCCACTCTATATACTATCATGCCTCACAAAACTGGACTCGGTACCGATTACAAGAACTTCG

AATCAG - UNI19346 - GTGTGTGGCCAGAAAGTTCCTGTATTTGTGGATTCGAGTGACTTTTGGAAGAGTGACTCCCTCTAGAGCCAG - UNI32

257 - GATTTTCCATGAGCAGAAAATATTACAGAAGGTCTTCGGAGAATGGAGGGAAGAATGGTGGGTCTCCCAGAGGGAGTGGAAGCTCTGTGTCCGA

GCTGACTGTCACTACAG - UNI32257 - ATACTACTTGTACAACCTGATTTTCCAGAACTGGAAGACCTTTGTGCACCAGCAACGGGAGATGAGGAA

GAGGTTCCGAATAGCTGAGCATCATG - UNI30568 - - UNI30633 - ATACGAAGCAGAAGATGTGCCAAGCCTGGAAGTCCTGGTTGATATAC

ATGGTTTCTCGTAGGACCAAACTTCACATGAAGACTACTGCTCTAGAGTTTAGGAGGCAGAGTGTCTTATG - UNI30568 - - UNI30633 - TT

TCTGGTGGAGCAAGTGGAGGTGGCGACTAGGACAAGCCCATGCAGAGCACGCTCTCCATGCAGTGGCTGTGAAGCACAGGGCCCTGAGCCTCCAGCTGCA

G - UNI30568 - - UNI34418 - GGTTGGCTGCGATGGCAAGAACAGCTTCTAATTAGCCAGCGAGATAGGAGGAAGGAGGCCACTGCTGTGCAA

CACTATCAGCACTGGCAGAAGCAGAGATCTCTGAAGGCTTGGCTTAAATACCTCCAAATCTGCAGGGTGAAGAGATGGCAGAATG - UNI33508 - -

 UNI34418 - AGATGGCTGTACAATTCCACCGTGCTACTGTGCTCCAGATACATTTCTGTGACTGGCAGTGGGCCTGGGAGTGGAGGCAGAGCTTGTC

TGCCCACCAGGCCCTGGTGGTGAAGCTGGCCGGGAGGATGGTCCTGCGGAGGGCCTTTACACACTGGAAGCACT - UNI33508 - - UNI34418 -

 ACATGTTGCTACAGGCAGAAGAGGCTGCCCAGCGCGAGGCAGCAGCTGAACACCGCCAGCACTACCTGCTG - UNI33508 - - UNI36648 - T

ATTCTTGCTTTAGAGCCTTCAAAGACAACGTGACCCAGGCCCGACTACAGCAAACAAGAAAGAAGCTTGCTCAGCAGCTGCGTGACACTACA - UNI32

554 - - UNI36648 - TTGCTTCACAGGTTCTGGAACCTCTGGCAGTCTCGAATTGAGCAGAGGGAGGAGAGGGTACAGACCCCCTCATTGCATGCA

GCCCTGAGCCACTACAG - UNI31688 - - UNI32554 - - UNI36648 - GGTGACAGTCCTACACAAGTGTGTCAGGGTGTGGCTACGGTAT

GTGCACAAGAGACAATGGCAGCAG - UNI31688 - - UNI32554 - TTATTGCGGGCCAGAGCAGATGGTCATTTCCAGCAGCGAGCACTGCCTG

CTGCCTTCTACACGTGGTACAGAGGCTGGCTATGGCACCAGCAGAGACGGATCCTGCACACAAAAGCAGTGCGTTTCCACAG - UNI31688 - AGGG

ACATTAGAGAAGCAAGTATTTGCTCTCTGGAGGCAGAAGATGTCTCAGCATCGAGAAAACTGCTTGGCAGAGAGAATG GCTATACTGCAGGCAGAGCAG

CAGCTTTTGCGTAGGTTCTGGTTCGTGTGGCACCAGCAGGCAGCAGTGTGTCAGCTGGAGCGACAGCAGCAAGCCATGGCCATTGCCCACCACCACAGTG

GACTGCTCAGGAGGGCTTTCTGCATCTGGAAGGAAAGCACCCAAGGATTTAGGATAGA GAGGATGGGCAGGGCACAGGCTGCGCACTTCCACTCTGCAC

AGCTCTTGAGTCGGGCCTGGAGCATGTGGAGGGAG TGCCTGGCCCTGAGGCTGGAAGAGCAGCAGAAACTGAAGTGTGCGGCCCTGCACAGCCAGTGCA

TCCTGCTTCGCAGGGCTCTGCAGAAGTGGCTG GTTTACCAGAATAGGGTGAGGAGTGTTCTGCGGGAGGTGGCGGCCAGGGAGAGACAGCACAACAGGC

AGCTGCTGTG - UNI35423 - GTGGGCGTTACATCTCTGGAGAGAAAACACCATGGCCCGTTTGGATGGAGCCAAAAAAACCTCTCAAGCAAGAGTT

CACTACAGCAGGACTCTGTGCTCCAAG - UNI33909 - - UNI35423 - GTCCTCGTCCAGTGGCGAGAGGTTACTTCAGTGCAGATATATTACC

GACAAAAGGAGGCAGCTGCCCTCAGGGAGGCCCGGAAAGCACTGGACAGGG - UNI33909 - - UNI35423 - GTCGTCTCCAGAACTGGTTTCA

GCACTGGCGATTCTGCAGCCAGAGGGCAGCCCAGCAGAGATTCCAGCTGGGACAGGCGGCTCAGCATCACCACTGGCAGCTGCTGATGGAAGCAATGGCC

AGGTGGAAGGCACACCATCTGGGGTGTATCAGAAAGAAG - UNI33909 - TTTCTGCAGAGGCAAGCTGCCCAACTCCTGGCACAGAGACTCAGTCG

GGCCTGCTTCTGCCAGTGGAGGAAGCAG CTGGCAGTCCGGAAGCAAGAACAGTGGGGCACAGCCCGGGCCCTGTGGCTCTGGGCCTTCTCACTACAAGC

AAAG GTGTGGACTGCATGGCTGGGCTTCGTACTTGAGAGGAGGAGGAAGAAGGCACGGCTGGAACGGGCTATGCAAGCCTACCAGCAGCAGCTCCTACA

GGAGGGTGCCACACGGCTTCTGCGCTTCACAGCTGGTACGAAGGCCTTCCGGCAGCAGCTCCAGGCCCAGCAGCAGGTCCAG GCAGCCCACAGCCTCCA

CTGTGCAGTCCGCCACTGTGCTGAGCTCTGGAAAAAGAAGGTGCTTGGTCCAGGCAAGACTTCTCAACCACCAGCACCCACCACATTCAGCAAGAGAGTG

ACATTTAAGGATTCTTTCCTCTCTGGACATGCTGCGGAGGCTGGAGATGCTACCCAGGAGACAAAGAAGCTTCGAGCTCCTCCATCTCAGGGAGTCCTGG

GTAGTTTGGCAGGAGCTGCTGGGGAGCCCTGCCACCTAGACCT CAATGCAGCCCGCTCATCACGGAAACAGCCCCGACGTCCATCCTTCCTGCTTGAGC

GTTTGGGGAGTCAGAGGTCCCCAGAGTGGTACAGCCTTGGGGAGCAGCA GTTAGAGAAGCCCCCAGAGGAGGAAAGCACGGCTCTGCTGGGAGGCTCTT

CCCTGACAAGACCCTTCCTACCTGGGGTCCTGCCGAATGTTCCTGGTCCGAAGCTGCCTCCTACGGCCAGTCCAGGCCTGGAGCTGCTGCCTCCCTCCTC

CATCATGCCCCATGCGGCAGGAGGCACTGCTAGG GTGTCAGCGAAGCCCAGCATCCCTGGGCCTCAGCCTTGGGGGTGCCCGTCCTTACCCAGGGACCT

TGATCCCCAACTCCTCCCTGGAGATTCCATAAGCACCCGGACTGAGCCTGTTTATGGCTCAGAGGCTACAG GCCACACAGAGCTTGAGGCTGAGTTGGA

GGGGATCCAGCAGCAGTTACAACACTACCAAACCACCAAGCAGAACCTTTG GTCATGCCAGCGACAAGCCAACAGCCTGCGTAGGTGGCTGGAGCTAAG

CCAGGAGGAGCCGAAATCCGAGGACCTTCACCTAGAAGAGCAGGTGAAAACAGAACTGGAGGAG GTGGAACTACAGGTCCAGCAGCTGGCTAAGGAGCT

TGAGGCCCAGCGTCAGCCTGTTGGTACATGCATTGCTCGTGTTCGGGCCCTGAGACGGGCACTGTGCTAGTGGCCCGTCCCTGGGGGATAGGTGCTATCC

TTCACAAGGCCTGGGACACCCTCAACAACAAAATTCAAAGCTATGGTAGTTTTTGTTTTGTTTTGTTTTTTAATTTCAAAATGTCTTGCAATGAAATGAA

TTACTGTTCAGAAGTCTCCTACTTTTCATACAAAATACGGTACTACT
Translation
 MEKKIGSR - UNI19346 - RSFRDGVVKKPCSPKTLPLKKSSAFSGIQREPSRSCHSIYYHASQNWTRYRLQELRIR - UNI19346 - RCVAR

KFLYLWIRVTFGRVTPSRAR - UNI32257 - RIFHEQKILQKVFGEWREEWWVSQREWKLCVRADCHYR - UNI32257 - RYYLYNLIFQNWKT

FVHQQREMRKRFRIAEHHD - UNI30568 - - UNI30633 - DTKQKMCQAWKSWLIYMVSRRTKLHMKTTALEFRRQSVLC - UNI30568 - 

- UNI30633 - CFWWSKWRWRLGQAHAEHALHAVAVKHRALSLQLQ - UNI30568 - - UNI34418 - GWLRWQEQLLISQRDRRKEATAVQH

YQHWQKQRSLKAWLKYLQICRVKRWQNE - UNI33508 - - UNI34418 - EMAVQFHRATVLQIHFCDWQWAWEWRQSLSAHQALVVKLAGRMVL

RRAFTHWKHY - UNI33508 - - UNI34418 - YMLLQAEEAAQREAAAEHRQHYLL - UNI33508 - - UNI36648 - YSCFRAFKDNVT

QARLQQTRKKLAQQLRDTT - UNI32554 - - UNI36648 - LLHRFWNLWQSRIEQREERVQTPSLHAALSHYR - UNI31688 - - UNI32

554 - - UNI36648 - RVTVLHKCVRVWLRYVHKRQWQQ - UNI31688 - - UNI32554 - LLRARADGHFQQRALPAAFYTWYRGWLWHQQ

RRILHTKAVRFHR - UNI31688 - RGTLEKQVFALWRQKMSQHRENCLAERM AILQAEQQLLRRFWFVWHQQAAVCQLERQQQAMAIAHHHSGLLR

RAFCIWKESTQGFRIE ERMGRAQAAHFHSAQLLSRAWSMWRE CLALRLEEQQKLKCAALHSQCILLRRALQKWL VYQNRVRSVLREVAARERQHNRQ

LLW - UNI35423 - WWALHLWRENTMARLDGAKKTSQARVHYSRTLCSK - UNI33909 - - UNI35423 - VLVQWREVTSVQIYYRQKEAA

ALREARKALDRG - UNI33909 - - UNI35423 - GRLQNWFQHWRFCSQRAAQQRFQLGQAAQHHHWQLLMEAMARWKAHHLGCIRKK - UNI3

3909 - FLQRQAAQLLAQRLSRACFCQWRKQ LAVRKQEQWGTARALWLWAFSLQAK VWTAWLGFVLERRRKKARLERAMQAYQQQLLQEGATRLLRF

TAGTKAFRQQLQAQQQVQ AAHSLHCAVRHCAELWKKKVLGPGKTSQPPAPTTFSKRVTFKDSFLSGHAAEAGDATQETKKLRAPPSQGVLGSLAGAAGE

PCHLDL LNAARSSRKQPRRPSFLLERLGSQRSPEWYSLGEQQ QLEKPPEEESTALLGGSSLTRPFLPGVLPNVPGPKLPPTASPGLELLPPSSIMPHA

AGGTAR VSAKPSIPGPQPWGCPSLPRDLDPQLLPGDSISTRTEPVYGSEATG GHTELEAELEGIQQQLQHYQTTKQNLW WSCQRQANSLRRWLELSQ

EEPKSEDLHLEEQVKTELEE VELQVQQLAKELEAQRQPVGTCIARVRALRRALC

For any suggestions or comments, please send an email to unitrap@crg.es