Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023809 (Rps6ka2)
Chromosomal location
Chr 17: 7374464 - 7507662 (+)
Description
ribosomal protein S6 kinase, polypeptide 2 Gene [Source:MGI Symbol;Acc:MGI:1342290]
RefSeq_dna
NM_011299 
RefSeq_peptide
NP_035429.1 
UniGene
Mm.412422 Mm.268383 
MGI
MGI:1342290 
Uniprot/SWISSPROT
Q9WUT3 
Uniprot/SPTREMBL
Q3V226 Q810Z3 Q8CHM5 Q7TPD5 
Human Ortholog
ENSG00000071242 (RPS6KA2)
Omim not available
UniTrap UNI31580
Vector Insertion
Chr 17: 7374793 - 7432261
Public Clones IST11964H8 (tigm) IST14692E5 (tigm) IST10235G7 (tigm) IST14819E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19909
Vector Insertion
Chr 17: 7440394 - 7440477
Public Clones not available
Private Clones OST377450 (lexicon) OST324916 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26759
Vector Insertion
Chr 17: 7440477 - 7451050
Public Clones not available
Private Clones OST99102 (lexicon) OST37637 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2681
Vector Insertion
Chr 17: 7476006 - 7481811
Public Clones AL0501 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097427
Sequence
CGGGCCCGGTGGCCGGTGCGGCCTGCCCTTTGTGCTTGCAGCCCGCATCCGCGCCGAGGGCCGCCGCGTCGGGCTCCCCGGCGCGCGTGCCCGCCAGCGC

GCTGCCTAGCCTGGGATGTGCCGGGGATGCGCGCCCGCCGGCCCTGCGGCTCCTGGCAGCTGGGCGCGGGGCGATGGAGCTGAGCATGAAGAAGTTCACG

GTGCGCAGGTTCTTCTCCGTGTACCTGCGCAAGAAGTCGCGCTCCAAGAGCTCCAGTCTGAGTCGCCTCGAG - UNI31580 - GAAGAAGGCATTGT

GAAGGAGATTGACATTAGCAACCATGTGAAGGAAGGCTTTGAGAAGGCAGACCCCTCCCAGTTCGAGCTACTAAAGGTTTTAGGACAAGGGTCGTATGGA

AAG - UNI19909 - GTGTTCTTGGTGAGGAAGGTTACAGGATCAGACGCTGGTCAGCTCTACGCCATGAAGGTCCTGAAGAAAGCCACCTTGAAAG 

- UNI19909 - - UNI26759 - TGCGAGACCGGGTCAGATCTAAGATGGAGAGAGACATCCTGGCAGAGGTGAATCACCCTTTCATTGTCAAGCTG

CATTATG CCTTTCAGACCGAAGGCAAGCTCTACCTGATCCTGGACTTCCTGCGGGGAGGTGACCTCTTCACCAGGCTTTCCAAAGAG GTGATGTTCAC

GGAGGAGGATGTCAAGTTCTACCTGGCTGAGCTGGCCTTGGCTCTAGACCACCTCCATGGCCTGGGGATCATCTACAGGGATCTGAAGCCAGAGAA TAT

CCTCCTGGATGAAGAGGGACACATTAAGATCACAG ATTTTGGCTTGAGCAAGGAGGCCACCGACCATGACAAGAGAGCCTATTCATTCTGTGGGACTAT

TGAATACATGGCGCCCGAGGTGGTGAACCGGCGTGGACACACACAGAGTGCCGACTGGTGGTCCTTCGGTGTGCTCATG CCCGACATCGTGCACACTTC

AGGTTAA
Translation
 - UNI31580 -  - UNI19909 - MKVLKKATLKV - UNI19909 - - UNI26759 - VRDRVRSKMERDILAEVNHPFIVKLHYA AFQTE

GKLYLILDFLRGGDLFTRLSKE VMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPEN NILLDEEGHIKITD DFGLSKEATDHDKRAYSFCGTIEYM

APEVVNRRGHTQSADWWSFGVLM PDIVHTSG
Transcript ENSMUST00000024619
Sequence
CCGGGAGCTGGTACTCCTGGCCGGAGGCAAAGGCGCCGCGGGAGTGATCCAGGGACCCGGGCCCGGTGGCCGGTGCGGCCTGCCCTTTGTGCTTGCAGCC

CGCATCCGCGCCGAGGGCCGCCGCGTCGGGCTCCCCGGCGCGCGTGCCCGCCAGCGCGCTGCCTAGCCTGGGATGTGCCGGGGATGCGCGCCCGCCGGCC

CTGCGGCTCCTGGCAGCTGGGCGCGGGGCGATGGAGCTGAGCATGAAGAAGTTCACGGTGCGCAGGTTCTTCTCCGTGTACCTGCGCAAGAAGTCGCGCT

CCAAGAGCTCCAGTCTGAGTCGCCTCGAG - UNI31580 - GAAGAAGGCATTGTGAAGGAGATTGACATTAGCAACCATGTGAAGGAAGGCTTTGAG

AAGGCAGACCCCTCCCAGTTCGAGCTACTAAAGGTTTTAGGACAAGGGTCGTATGGAAAG - UNI19909 - GTGTTCTTGGTGAGGAAGGTTACAGG

ATCAGACGCTGGTCAGCTCTACGCCATGAAGGTCCTGAAGAAAGCCACCTTGAAAG - UNI19909 - - UNI26759 - TGCGAGACCGGGTCAGA

TCTAAGATGGAGAGAGACATCCTGGCAGAGGTGAATCACCCTTTCATTGTCAAGCTGCATTATG CCTTTCAGACCGAAGGCAAGCTCTACCTGATCCTG

GACTTCCTGCGGGGAGGTGACCTCTTCACCAGGCTTTCCAAAGAG GTGATGTTCACGGAGGAGGATGTCAAGTTCTACCTGGCTGAGCTGGCCTTGGCT

CTAGACCACCTCCATGGCCTGGGGATCATCTACAGGGATCTGAAGCCAGAGAA TATCCTCCTGGATGAAGAGGGACACATTAAGATCACAG ATTTTGG

CTTGAGCAAGGAGGCCACCGACCATGACAAGAGAGCCTATTCATTCTGTGGGACTATTGAATACATGGCGCCCGAGGTGGTGAACCGGCGTGGACACACA

CAGAGTGCCGACTGGTGGTCCTTCGGTGTGCTCATG TTCGAGATGCTCACAGGGTCCCTGCCATTCCAGGGGAAGGACAGGAAGGAAACAATGGCCCTC

ATCCTCAA AGCCAAGCTGGGTATGCCTCAGTTCCTCAGTGCGGAGGCTCAGAGCCTGCTCAGGGCCCTTTTCAAGCGGAACCCCTGCAACAGGCTAG G

TGCTGGTGTTGATGGAGTGGAGGAAATTAAACGTCACCCGTTCTTTGTCACCATAGACTGGAAT - UNI2681 - AAGCTGTACCGCAAGGAGATCAA

GCCACCCTTCAAGCCAGCAGTGGGCAGGCCTGAGGACACCTTCCACTTTGACCCCGAGTTTACTGCAAGGACCCCCACAG ATTCTCCTGGTGTCCCCCC

AAGTGCAAACGCCCACCACCTCTTCAGAGGATTCAGCTTTGTGGCCTCCAGCCTGGTCCAGGAGCCCTCACAGCAAGACGTGCCCAAGGCCCCCATTCAC

CCAATTGTGCAG CAGCTACATGGGAACAACATCCACTTCACTGACGGCTATGAGATCAAGGAGGACATCGGGGTGGGCTCCTACTCAGTGTGCAAGCGG

TGTGTACACAAAGCCACGGATGCTGAGTATGCTGTGAAG ATCATCGATAAGAGCAAAAGGGACCCCTCGGAGGAGATTGAGATCCTCCTGCGCTATGGC

CAGCACCCCAACATCATCACCCTAAAAGAT GTCTATGATGATGGCAAGTACGTCTACCTGGTGATGGAGCTCATGCGAGGCGGGGAGCTGCTGGACCGT

ATCCTCCGTCAGCGGTGCTTCTCAGAGCGTGAGGCCAGTGATGTGCTCTATACCATCGCCAGGACCATGGACTACCTGCACTCCCAAGGG GTGGGGCTA

CCTGCACTCCCAGTG GTTGTCCATCGGGACCTGAAACCAAGTAACATTCTGTACATGGATGAGTCTGGAAACCCCGAATCTATCCGCATCTGTGACTTT

GGGTTTGCCAAACAGCTTCGAGCGGAGAATGGGCTGCTCATGACCCCCTGCTATACTGCAAACTTTGTAGCTCCCGAG GTCTTGAAGCGGCAAGGCTAC

GATGCAGCGTGTGATGTCTGGAGCTTGGGAATCCTGCTGTACACCATGCTGGCTGG GTTCACTCCGTTTGCCAATGGCCCAGACGATACCCCTGAGGAG

ATTCTGGCTAGGATCGGCAGTGGGAAGTACGCCCTTTCTGGGGGAAACTGGGACTCCATATCTGATGCAGCAAAA GATGTCGTGTCCAAGATGCTCCAC

GTGGACCCTCAGCAACGCCTAACAGCAGTTCAAGTGTTGAAGCACCCGTGGATCGTGAACAGAGAGTACCTATCCCAAAACCAGCTGAGCAGACAGGATG

TCCATCTAGTGAAG GGTGCCATGGCGGCCACCTACTTTGCTCTGAACAGGACCCCACAGGCACCGAGGCTAGAGCCTGTGCTCTCATCTAGCTTGGCCC

AACGCAGAGGCATGAAGAGACTCACGTCTACCAGGTTGTAGTGGCCAGCCAAGTCTCCAGCCTCAGTCGCCCTGCCCAACGTCCTCTCAGCCTCACAGAC

ACCAGACATAGGTCCTGTTCATGGGCACTTGAGTGCCCATGAGTCCAGCACAAAGATGGATCTGGCCTTGGCTGTCTCTCTGTTTCCTTTGCAGCCCTGG

AAAGGGTCCTGCCCAGGATGTCTGAGCCTTGCTGCACCGACCTCGCCGCCCGCTCTCTCTCCTCCTGAGTGAAACCAAATGAATCTGTCACCTCATAGCA

CCCTGCTGGGGCCTCCCTGGGCTCACTCAGGGCTCTCAGTGTCTCCATGTCATGGCTTATGCCCAAAGCAGAGCTCTTTTACCATCCTGATGTCACCTAC

GTGTCCCACTGTCTCTCTGAGAGTGTTAGTGCACAGTCCCTGCCTGGAGACAGCAGAGCCACAGCAGAGCTGGATGTTCCTGGATGTTCTGGCAATGCCA

GTGGCCATGTGAAAGCATCCAGCTTAGATGCCTGGCTCTGTCCACAATCACCCAAAGAGTGCTCCTCACCACCCTCCTGCTCTCAAGCAAGATGCTGGGT

AGCCTCTCCCTGACTCTGTCTCTGACTTGGCAGGATGAAAGCAACCAACCCAAGAGTCTAGATGGCTAGAGTCTATTTGAGAGCGTGATTCCTGTTGGTT

GAGACAGGAGCCCCAGGAAATTGCCGGGCAGAGCCAGTACCCACTACACTGCTGCCCCCTTAACCCTGTGGCCCCAGGGACACTGGAGAGAGTGGGGCTC

TGCCATTGCTGGGTGTGTTGGCATCTCTGCTCATATTTGCCTGCTGTGGTATAGCATATTCACTCTCTCTCTGCTTTCCTGGGCCACAGAGAATGTCTTC

TCCTCTATCCCTCTATCCCTTCTTGACTGAGGACAGGAGAGACACCTGAGCCCCTTGCCTTAGACAGGCAGAAGGTGCCTGGACAAGTTGTCAGTGGGAG

TGATGCTCTTCTTAGAAGCTGTGGTCCTATGTTGCATCTTGTGTTTCTGTTGTCTAGCCTGTTTTCAGGCTGTAGTCTGCGCAGGGAGCAGTAGTTACAC

GGACCAGGCTATCTGTGGCATACTCTTCATGCAGAGTAACCGAGTGAGACCCTTCCCCCGTGGCGTGCTCCACTCCTCCTGGTCGGAGAGGAGGGACTTG

TGTGTCCTGAAGTCTCTCTGGAGGCTGCTGAGGATAGTGGACTCAGGTCAGAAGACACTCCACTGTGGCTCAGAACCTGCCAGTCTGAGAAGCAGCCCCT

CTGCCCAGTAGAGGCACCTGTAGGAGGCGCCTGTTGGTCACAGCAGGCTTACACTAGGAAGACCACAGGTGGACCACGGCTGCTTCTGCAATGCCTGCCC

CAGTGGAATGTTCAGAACATAATTCCTTTGCTCAGTCTAATTATTTCAGACCTCAAAACGTAAACGTATTTCTGAAGCTTTAATTACTCCACTGGACTCT

GTTCTGTTTGAGAATTATAAAATACAGAGTGGGGATAGACTGTGTGCCATTTCCAGTGTCCCTGGGGATGGTCTCCTGCTTTCTCAGTGGATGCTCTGCC

CAAGGCTGAGATCATCTCCCAGTTAATGTTCTGGGCCCGAATCCTTGCGATTCTTGATAGAAATCCAGAGGGAAAGTATAGTGGGTAGTCTTAGTGACGG

ATTCTGTCCTCTGGGAAATGAACAGGAGCTCTGGCACCCTCCGAGGGCCTCTCTGGCATGCACCCTTGCTCCAGCTGCTCACGGCTCAGGCTGGGTTTGC

TTGCAGCTTCAAGTGTACATGTTCCAATGAAAAGAAAGAACAACAGAACACAGAAGGCATGGCTGAGGAGGCGAGCATAGCCTGTCCCTCTCATGGTCAC

GTGGCCGCATCACCTCTTTCAGTAATGTGAGGTTACCTGCTTTACACTCAGCCTACTCTCGCCAAATAGATGGAGGAGACCATCAGTCAAAACAAACGCA

TCCTTGAAGTGTCTGGAAGGATGCTCAGCCTTGCCCTGCAGAGAGTGGAGTACCCCACATTCCCACCTCACCCAGTACTTGATACTTGAAATCTCTCGTG

GAGTCAGCCAGAGGAGCACGTGACAGGATCGTTTTAATCCCTGTTCTTTAAAGTCTTCAGTGCCACAGCAGTCTGCTGTGGCATGTAACCCCGTGTCCCC

AGTGTTTACCTGGCCTGTGACCCTTTACCCAACATGAGGAAAGGCTCTGTATTCTCTACACAAATGACTACTTGTGTAGCTACAGAATTTGTCATGGGAA

AGCCCAGCCTACATCCTGGGACTCCTTTACCCATCCCCCAGAGCTACTTTTGGGCTATCCCACTGCAGCTCCTGCCCTGTTTGGGCTGAGAACATGATGA

GCGCTCCACTGAAGGAGGTGGGGATGGGGTGCTTGTCAGATTCTGTACCCCAGAGTCAATGGCAGGCAAGCCGTGAACGTCCCCTGTCCTATGGTTGGAA

CGTGTGTGATTTTGAACTACCTGTGTGCACTGGTCTTTGGATATTGTTTGGCTTTTTAAGTGAGGATCGTCCTGATGGTATCTAATGTCAGCAGTATTCC

TGATTAAATGGTGTTCTTCCTTAAGATGCCCTTTGGGATTTCCCCTGCATTGTACCGCTTCTCTCAAGCACAGGAGGAGATACACCGTGACTCTTCATTC

TCTCTGGCACATTTTGCCGCCCTTCACCACCCGCAAGACTGTGAGACACCTAGAGTGGGAAAGGTCTCTGGGGTCCCTCTGTGGCAGGGACAGGTGGAAG

GGGAAGCCAGCATGGCTCATCGGTGCAGGTGAAAGGCACCACCCCACTCCCAGCCCGCGCTGCGTTTACATGATCAGCAGTTCCGTTTACAGCTCACTCC

ATGTTCACACTTTCTGGCTGTGTGTTGAGACGGCGGCCACTGTACAGATATTTATTATGCTTTCCAAACTTTCCCATGAGATTTTTTGAATAAACATGGA

TTTTATGAAGTGT
Translation
MKKFTVRRFFSVYLRKKSRSKSSSLSRLE - UNI31580 - EEGIVKEIDISNHVKEGFEKADPSQFELLKVLGQGSYGK - UNI19909 - VFLV

RKVTGSDAGQLYAMKVLKKATLKV - UNI19909 - - UNI26759 - VRDRVRSKMERDILAEVNHPFIVKLHYA AFQTEGKLYLILDFLRGGDL

FTRLSKE VMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPEN NILLDEEGHIKITD DFGLSKEATDHDKRAYSFCGTIEYMAPEVVNRRGHTQSAD

WWSFGVLM FEMLTGSLPFQGKDRKETMALILK KAKLGMPQFLSAEAQSLLRALFKRNPCNRLG GAGVDGVEEIKRHPFFVTIDWN - UNI2681 -

 KLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTD DSPGVPPSANAHHLFRGFSFVASSLVQEPSQQDVPKAPIHPIVQ QLHGNNIHFTDGYEIKED

IGVGSYSVCKRCVHKATDAEYAVK IIDKSKRDPSEEIEILLRYGQHPNIITLKD VYDDGKYVYLVMELMRGGELLDRILRQRCFSEREASDVLYTIAR

TMDYLHSQG VGLPALPV VVHRDLKPSNILYMDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPE VLKRQGYDAACDVWSLGILLYTMLAG

 GFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAK DVVSKMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVK GAMAATYFALN

RTPQAPRLEPVLSSSLAQRRGMKRLTSTRL
Transcript ENSMUST00000024575
Sequence
CCGGGAGCTGGTACTCCTGGCCGGAGGCAAAGGCGCCGCGGGAGTGATCCAGGGACCCGGGCCCGGTGGCCGGTGCGGCCTGCCCTTTGTGCTTGCAGCC

CGCATCCGCGCCGAGGGCCGCCGCGTCGGGCTCCCCGGCGCGCGTGCCCGCCAGCGCGCTGCCTAGCCTGGGATGTGCCGGGGATGCGCGCCCGCCGGCC

CTGCGGCTCCTGGCAGCTGGGCGCGGGGCGATGGAGCTGAGCATGAAGAAGTTCACGGTGCGCAGGTTCTTCTCCGTGTACCTGCGCAAGAAGTCGCGCT

CCAAGAGCTCCAGTCTGAGTCGCCTCGAG - UNI31580 - GAAGAAGGCATTGTGAAGGAGATTGACATTAGCAACCATGTGAAGGAAGGCTTTGAG

AAGGCAGACCCCTCCCAGTTCGAGCTACTAAAGGTTTTAGGACAAGGGTCGTATGGAAAG - UNI19909 - GTGTTCTTGGTGAGGAAGGTTACAGG

ATCAGACGCTGGTCAGCTCTACGCCATGAAGGTCCTGAAGAAAGCCACCTTGAAAG - UNI19909 - - UNI26759 - TGCGAGACCGGGTCAGA

TCTAAGATGGAGAGAGACATCCTGGCAGAGGTGAATCACCCTTTCATTGTCAAGCTGCATTATG CCTTTCAGACCGAAGGCAAGCTCTACCTGATCCTG

GACTTCCTGCGGGGAGGTGACCTCTTCACCAGGCTTTCCAAAGAG GTGATGTTCACGGAGGAGGATGTCAAGTTCTACCTGGCTGAGCTGGCCTTGGCT

CTAGACCACCTCCATGGCCTGGGGATCATCTACAGGGATCTGAAGCCAGAGAA TATCCTCCTGGATGAAGAGGGACACATTAAGATCACAG ATTTTGG

CTTGAGCAAGGAGGCCACCGACCATGACAAGAGAGCCTATTCATTCTGTGGGACTATTGAATACATGGCGCCCGAGGTGGTGAACCGGCGTGGACACACA

CAGAGTGCCGACTGGTGGTCCTTCGGTGTGCTCATG TTCGAGATGCTCACAGGGTCCCTGCCATTCCAGGGGAAGGACAGGAAGGAAACAATGGCCCTC

ATCCTCAA AGCCAAGCTGGGTATGCCTCAGTTCCTCAGTGCGGAGGCTCAGAGCCTGCTCAGGGCCCTTTTCAAGCGGAACCCCTGCAACAGGCTAG G

TGCTGGTGTTGATGGAGTGGAGGAAATTAAACGTCACCCGTTCTTTGTCACCATAGACTGGAAT - UNI2681 - AAGCTGTACCGCAAGGAGATCAA

GCCACCCTTCAAGCCAGCAGTGGGCAGGCCTGAGGACACCTTCCACTTTGACCCCGAGTTTACTGCAAGGACCCCCACAG ATTCTCCTGGTGTCCCCCC

AAGTGCAAACGCCCACCACCTCTTCAGAGGATTCAGCTTTGTGGCCTCCAGCCTGGTCCAGGAGCCCTCACAGCAAGACGTGCCCAAGGCCCCCATTCAC

CCAATTGTGCAG CAGCTACATGGGAACAACATCCACTTCACTGACGGCTATGAGATCAAGGAGGACATCGGGGTGGGCTCCTACTCAGTGTGCAAGCGG

TGTGTACACAAAGCCACGGATGCTGAGTATGCTGTGAAG ATCATCGATAAGAGCAAAAGGGACCCCTCGGAGGAGATTGAGATCCTCCTGCGCTATGGC

CAGCACCCCAACATCATCACCCTAAAAGAT GTCTATGATGATGGCAAGTACGTCTACCTGGTGATGGAGCTCATGCGAGGCGGGGAGCTGCTGGACCGT

ATCCTCCGTCAGCGGTGCTTCTCAGAGCGTGAGGCCAGTGATGTGCTCTATACCATCGCCAGGACCATGGACTACCTGCACTCCCAAGGG GTTGTCCAT

CGGGACCTGAAACCAAGTAACATTCTGTACATGGATGAGTCTGGAAACCCCGAATCTATCCGCATCTGTGACTTTGGGTTTGCCAAACAGCTTCGAGCGG

AGAATGGGCTGCTCATGACCCCCTGCTATACTGCAAACTTTGTAGCTCCCGAG GTCTTGAAGCGGCAAGGCTACGATGCAGCGTGTGATGTCTGGAGCT

TGGGAATCCTGCTGTACACCATGCTGGCTGG GTTCACTCCGTTTGCCAATGGCCCAGACGATACCCCTGAGGAGATTCTGGCTAGGATCGGCAGTGGGA

AGTACGCCCTTTCTGGGGGAAACTGGGACTCCATATCTGATGCAGCAAAA GATGTCGTGTCCAAGATGCTCCACGTGGACCCTCAGCAACGCCTAACAG

CAGTTCAAGTGTTGAAGCACCCGTGGATCGTGAACAGAGAGTACCTATCCCAAAACCAGCTGAGCAGACAGGATGTCCATCTAGTGAAG GGTGCCATGG

CGGCCACCTACTTTGCTCTGAACAGGACCCCACAGGCACCGAGGCTAGAGCCTGTGCTCTCATCTAGCTTGGCCCAACGCAGAGGCATGAAGAGACTCAC

GTCTACCAGGTTGTAGTGGCCAGCCAAGTCTCCAGCCTCAGTCGCCCTGCCCAACGTCCTCTCAGCCTCACAGACACCAGACATAGGTCCTGTTCATGGG

CACTTGAGTGCCCATGAGTCCAGCACAAAGATGGATCTGGCCTTGGCTGTCTCTCTGTTTCCTTTGCAGCCCTGGAAAGGGTCCTGCCCAGGATGTCTGA

GCCTTGCTGCACCGACCTCGCCGCCCGCTCTCTCTCCTCCTGAGTGAAACCAAATGAATCTGTCACCTCATAGCACCCTGCTGGGGCCTCCCTGGGCTCA

CTCAGGGCTCTCAGTGTCTCCATGTCATGGCTTATGCCCAAAGCAGAGCTCTTTTACCATCCTGATGTCACCTACGTGTCCCACTGTCTCTCTGAGAGTG

TTAGTGCACAGTCCCTGCCTGGAGACAGCAGAGCCACAGCAGAGCTGGATGTTCCTGGATGTTCTGGCAATGCCAGTGGCCATGTGAAAGCATCCAGCTT

AGATGCCTGGCTCTGTCCACAATCACCCAAAGAGTGCTCCTCACCACCCTCCTGCTCTCAAGCAAGATGCTGGGTAGCCTCTCCCTGACTCTGTCTCTGA

CTTGGCAGGATGAAAGCAACCAACCCAAGAGTCTAGATGGCTAGAGTCTATTTGAGAGCGTGATTCCTGTTGGTTGAGACAGGAGCCCCAGGAAATTGCC

GGGCAGAGCCAGTACCCACTACACTGCTGCCCCCTTAACCCTGTGGCCCCAGGGACACTGGAGAGAGTGGGGCTCTGCCATTGCTGGGTGTGTTGGCATC

TCTGCTCATATTTGCCTGCTGTGGTATAGCATATTCACTCTCTCTCTGCTTTCCTGGGCCACAGAGAATGTCTTCTCCTCTATCCCTCTATCCCTTCTTG

ACTGAGGACAGGAGAGACACCTGAGCCCCTTGCCTTAGACAGGCAGAAGGTGCCTGGACAAGTTGTCAGTGGGAGTGATGCTCTTCTTAGAAGCTGTGGT

CCTATGTTGCATCTTGTGTTTCTGTTGTCTAGCCTGTTTTCAGGCTGTAGTCTGCGCAGGGAGCAGTAGTTACACGGACCAGGCTATCTGTGGCATACTC

TTCATGCAGAGTAACCGAGTGAGACCCTTCCCCCGTGGCGTGCTCCACTCCTCCTGGTCGGAGAGGAGGGACTTGTGTGTCCTGAAGTCTCTCTGGAGGC

TGCTGAGGATAGTGGACTCAGGTCAGAAGACACTCCACTGTGGCTCAGAACCTGCCAGTCTGAGAAGCAGCCCCTCTGCCCAGTAGAGGCACCTGTAGGA

GGCGCCTGTTGGTCACAGCAGGCTTACACTAGGAAGACCACAGGTGGACCACGGCTGCTTCTGCAATGCCTGCCCCAGTGGAATGTTCAGAACATAATTC

CTTTGCTCAGTCTAATTATTTCAGACCTCAAAACGTAAACGTATTTCTGAAGCTTTAATTACTCCACTGGACTCTGTTCTGTTTGAGAATTATAAAATAC

AGAGTGGGGATAGACTGTGTGCCATTTCCAGTGTCCCTGGGGATGGTCTCCTGCTTTCTCAGTGGATGCTCTGCCCAAGGCTGAGATCATCTCCCAGTTA

ATGTTCTGGGCCCGAATCCTTGCGATTCTTGATAGAAATCCAGAGGGAAAGTATAGTGGGTAGTCTTAGTGACGGATTCTGTCCTCTGGGAAATGAACAG

GAGCTCTGGCACCCTCCGAGGGCCTCTCTGGCATGCACCCTTGCTCCAGCTGCTCACGGCTCAGGCTGGGTTTGCTTGCAGCTTCAAGTGTACATGTTCC

AATGAAAAGAAAGAACAACAGAACACAGAAGGCATGGCTGAGGAGGCGAGCATAGCCTGTCCCTCTCATGGTCACGTGGCCGCATCACCTCTTTCAGTAA

TGTGAGGTTACCTGCTTTACACTCAGCCTACTCTCGCCAAATAGATGGAGGAGACCATCAGTCAAAACAAACGCATCCTTGAAGTGTCTGGAAGGATGCT

CAGCCTTGCCCTGCAGAGAGTGGAGTACCCCACATTCCCACCTCACCCAGTACTTGATACTTGAAATCTCTCGTGGAGTCAGCCAGAGGAGCACGTGACA

GGATCGTTTTAATCCCTGTTCTTTAAAGTCTTCAGTGCCACAGCAGTCTGCTGTGGCATGTAACCCCGTGTCCCCAGTGTTTACCTGGCCTGTGACCCTT

TACCCAACATGAGGAAAGGCTCTGTATTCTCTACACAAATGACTACTTGTGTAGCTACAGAATTTGTCATGGGAAAGCCCAGCCTACATCCTGGGACTCC

TTTACCCATCCCCCAGAGCTACTTTTGGGCTATCCCACTGCAGCTCCTGCCCTGTTTGGGCTGAGAACATGATGAGCGCTCCACTGAAGGAGGTGGGGAT

GGGGTGCTTGTCAGATTCTGTACCCCAGAGTCAATGGCAGGCAAGCCGTGAACGTCCCCTGTCCTATGGTTGGAACGTGTGTGATTTTGAACTACCTGTG

TGCACTGGTCTTTGGATATTGTTTGGCTTTTTAAGTGAGGATCGTCCTGATGGTATCTAATGTCAGCAGTATTCCTGATTAAATGGTGTTCTTCCTTAAG

ATGCCCTTTGGGATTTCCCCTGCATTGTACCGCTTCTCTCAAGCACAGGAGGAGATACACCGTGACTCTTCATTCTCTCTGGCACATTTTGCCGCCCTTC

ACCACCCGCAAGACTGTGAGACACCTAGAGTGGGAAAGGTCTCTGGGGTCCCTCTGTGGCAGGGACAGGTGGAAGGGGAAGCCAGCATGGCTCATCGGTG

CAGGTGAAAGGCACCACCCCACTCCCAGCCCGCGCTGCGTTTACATGATCAGCAGTTCCGTTTACAGCTCACTCCATGTTCACACTTTCTGGCTGTGTGT

TGAGACGGCGGCCACTGTACAGATATTTATTATGCTTTCCAAACTTTCCCATGAGATTTTTTGAATAAACATGGATTTTATGAAGTGT
Translation
MELSMKKFTVRRFFSVYLRKKSRSKSSSLSRLE - UNI31580 - EEGIVKEIDISNHVKEGFEKADPSQFELLKVLGQGSYGK - UNI19909 - 

VFLVRKVTGSDAGQLYAMKVLKKATLKV - UNI19909 - - UNI26759 - VRDRVRSKMERDILAEVNHPFIVKLHYA AFQTEGKLYLILDFLR

GGDLFTRLSKE VMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPEN NILLDEEGHIKITD DFGLSKEATDHDKRAYSFCGTIEYMAPEVVNRRGHT

QSADWWSFGVLM FEMLTGSLPFQGKDRKETMALILK KAKLGMPQFLSAEAQSLLRALFKRNPCNRLG GAGVDGVEEIKRHPFFVTIDWN - UNI26

81 - KLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTD DSPGVPPSANAHHLFRGFSFVASSLVQEPSQQDVPKAPIHPIVQ QLHGNNIHFTDGYE

IKEDIGVGSYSVCKRCVHKATDAEYAVK IIDKSKRDPSEEIEILLRYGQHPNIITLKD VYDDGKYVYLVMELMRGGELLDRILRQRCFSEREASDVLY

TIARTMDYLHSQG VVHRDLKPSNILYMDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPE VLKRQGYDAACDVWSLGILLYTMLAG GFTP

FANGPDDTPEEILARIGSGKYALSGGNWDSISDAAK DVVSKMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVK GAMAATYFALNRTPQA

PRLEPVLSSSLAQRRGMKRLTSTRL

For any suggestions or comments, please send an email to unitrap@crg.es