Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023826 (Park2)
Chromosomal location
Chr 17: 11259991 - 12256227 (+)
Description
Parkinson disease (autosomal recessive, juvenile) 2, parkin Gene [Source:MGI Symbol;Acc:MGI:1355296]
RefSeq_peptide
NP_057903.1 
MGI
MGI:1355296 
Uniprot/SWISSPROT
Q9WVS6 
Uniprot/SPTREMBL
Q2KHJ9 Q7TPF7 Q7TPF8 Q8K1N5 
Human Ortholog
ENSG00000185345 (PARK2)
Omim 168600 - PARKINSON DISEASE  600116 - PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE  
UniTrap UNI32859
Vector Insertion
Chr 17: 11260159 - 11430327
Public Clones (sanger) IST14746D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30806
Vector Insertion
Chr 17: 11685661 - 11828175
Public Clones (sanger) IST14978B10 (tigm) IST11517H9 (tigm) IST12541G9 (tigm) IST12178E3 (tigm)
IST13821E5 (tigm) IST11877F12 (tigm) IST12456E1 (tigm) IST13689A11 (tigm)
IST12037H8 (tigm) IST11419E6 (tigm) IST11074G3 (tigm) IST13583E7 (tigm)
IST12394A1 (tigm) IST11618D12 (tigm) IST11809F11 (tigm) IST10212E1 (tigm)
IST10248B10 (tigm) IST12143D4 (tigm) IST12641D2 (tigm) IST10720H7 (tigm)
IST12291D12 (tigm) IST13681D2 (tigm) IST10500E2 (tigm) IST14677C12 (tigm)
IST13806B4 (tigm) IST11834A9 (tigm) IST12493C11 (tigm) IST10232B4 (tigm)
IST12527G10 (tigm) IST10009B7 (tigm) IST11903C2 (tigm) IST13626C10 (tigm)
IST14721E3 (tigm) IST14458F7 (tigm) IST10793F7 (tigm) IST12044E6 (tigm)
IST12399A3 (tigm) IST10573E7 (tigm) IST10559H6 (tigm) IST10935D3 (tigm)
IST14897B5 (tigm) IST11563E4 (tigm) IST10892B10 (tigm) IST10557G12 (tigm)
IST11880D8 (tigm) IST12252F5 (tigm) IST14884C10 (tigm) IST12442A3 (tigm)
IST15032C10 (tigm) IST10125D3 (tigm) IST14315D6 (tigm) IST10865B7 (tigm)
IST11512H9 (tigm) IST10904F5 (tigm) IST10643F3 (tigm) IST12434C11 (tigm)
IST13273G7 (tigm) IST12855C6 (tigm) IST13423D3 (tigm) IST11153D1 (tigm)
IST10567D4 (tigm) IST15025D9 (tigm) IST13810G8 (tigm) IST11036D7 (tigm)
IST12697F12 (tigm) IST10801G11 (tigm) IST10852H5 (tigm) IST13656G7 (tigm)
IST10595A5 (tigm) IST10587D10 (tigm) IST10643A7 (tigm) IST14995C2 (tigm)
IST12087F9 (tigm) IST10319C8 (tigm) IST15102H4 (tigm) IST14487B6 (tigm)
IST10719F6 (tigm) IST13746F8 (tigm) IST13539E7 (tigm) IST12673G7 (tigm)
IST10704A1 (tigm) IST12649G1 (tigm) IST11908A4 (tigm) IST12250H5 (tigm)
IST12440B10 (tigm) IST11254G8 (tigm) IST10140H12 (tigm) IST13707H3 (tigm)
IST12698H11 (tigm) IST14980G1 (tigm) IST11354B12 (tigm) IST12586B8 (tigm)
IST11806H7 (tigm) IST12331A12 (tigm) IST14800G4 (tigm) IST10064F5 (tigm)
IST15084C11 (tigm) IST11390E10 (tigm) IST12973B6 (tigm) IST12238A10 (tigm)
IST14750D12 (tigm) IST11621B12 (tigm) IST13561A9 (tigm) IST12046H6 (tigm)
IST11493B7 (tigm) IST10991D12 (tigm) IST13720E11 (tigm) IST10564C2 (tigm)
IST12356F7 (tigm) IST14668H5 (tigm) IST13110E12 (tigm) IST13409B1 (tigm)
IST12103G4 (tigm) IST11192D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32036
Vector Insertion
Chr 17: 12047743 - 12196910
Public Clones IST12689E6 (tigm) IST14633G9 (tigm) IST13311B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32248
Vector Insertion
Chr 17: 12196995 - 12243491
Public Clones (sanger) IST15074H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115696
Sequence
TAGTGTTTGTCAGGTTCAACTCCAGCTATGGCTTCCCAGTGGAGGTCGATTCTGACACCAGCATCTTGCAGCTCAAGGAAGTGGTTGCTAAGCGACAGGG

GGTTCCAGCTGACCAGCTGCGTGTGATTTTTGCCGGGAAGGAGCTTCCGAATCACCTGACGGTTCAA - UNI32859 - AACTGTGACCTGGAACAAC

AGAGTATTGTACACATAGTACAGAGACCACGGAGGAGAAGTCATGAAACAAATGCATCTGGAGGGGACGAACCCCAGAGCACCTCAGAGGGCTCCATATG

GGAGTCCAGGAGCTTGACACGAGTGGACCTGAGCAGCCATACCCTGCCGGTGGACTCTGTGGGGCTGGCGGTCATTCTGGACACAGACAGTAAGAGGGAT

TCAGAAGCAGCCAGAGGTCCAG CAAAACCCAACCTTTCTACTTATTTTCTC
Translation
VFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQ - UNI32859 - NCDLEQQSIVHIVQRPRRRSHETNASGGDEP

QSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPA AKPNLSTYFL
Transcript ENSMUST00000066658
Sequence
CTAGTGTTTGTCAGGTTCAACTCCAGCTATGGCTTCCCAGTGGAGGTCGATTCTGACACCAGCATCTTGCAGCTCAAGGAAGTGGTTGCTAAGCGACAGG

GGGTTCCAGCTGACCAGCTGCGTGTGATTTTTGCCGGGAAGGAGCTTCCGAATCACCTGACGGTTCAA - UNI32859 - AACTGTGACCTGGAACAA

CAGAGTATTGTACACATAGTACAGAGACCACGGAGGAGAAGTCATGAAACAAATGCATCTGGAGGGGACGAACCCCAGAGCACCTCAGAGGGCTCCATAT

GGGAGTCCAGGAGCTTGACACGAGTGGACCTGAGCAGCCATACCCTGCCGGTGGACTCTGTGGGGCTGGCGGTCATTCTGGACACAGACAGTAAGAGGGA

TTCAGAAGCAGCCAGAGGTCCAG TTAAACCCACCTACAACAGCTTTTTCATCTACTGCAAAGGCCCCTGCCACAAGGTCCAGCCTGGAAAGCTCCGAGT

TCAGTGTGGCACCTGCAAACAAGCAACCCTCACCTTGGCCCAG GGCCCATCTTGCTGGGACGATGTCTTAATTCCAAACCGGATGAGTGGTGAGTGCCA

GTCTCCAGACTGCCCTGGAACCAGAGCT GAATTTTTCTTTAAATGTGGAGCACACCCAACCTCAGACAAGGACACGTCGGTAGCTTTGAACCTGATCAC

CAGCAACAGGCGCAGCATCCCTTGCATAGCGTGCACAGATGTCAG - UNI30806 - GAGCCCTGTCCTGGTCTTCCAGTGTAACCACCGTCACGTGA

TCTGTTTGGACTGTTTCCACTTGTATTGTGTCACAAGACTCAACGATCGGCAGTTTGTCCACGATGCTCAACTTGGCTACTCCCTGCCGTGTGTAG CTG

GCTGTCCCAACTCCCTGATTAAAGAGCTCCATCACTTCAGGATCCTTGGAGAAGAGCAG TACACTAGGTACCAGCAGTATGGGGCCGAGGAATGCGTGC

TGCAAATGGGAGGTGTGCTGTGCCCCCGTCCTGGCTGTGGAGCTGGACTGCTACCTGAACAGGGCCAGAGGAAAGTCACCTGCGAAGGGGGCAACGGCCT

GGGCTGCGGG - UNI32036 - TTTGTTTTCTGCCGGGACTGTAAGGAAGCATACCATGAAGGGGATTGCGACTCACTGCTCGAACCCTCAGGAGCCA

CTTCTCAG - UNI32248 - GCCTACAGGGTGGACAAAAGAGCCGCTGAGCAAGCTCGCTGGGAGGAGGCCTCCAAGGAAACCATCAAGAAGACCACC

AAGCCTTGTCCTCGCTGCAACGTGCCAATTGAAAAAAACG GAGGATGTATGCACATGAAGTGTCCTCAGCCCCAGTGCAAGCTGGAGTGGTGCTGGAAC

TGTGGCTGTGAGTGGAACCGAGCCTGCATGGGAGATCACTGGTTTGACGTGTAGAGAGAGATGTCACTTGGCCCTGGACGCACAACCTCAAGGGAAACTC

CGAAGATTCCTACCTTCCTTAGCCATTTCTTCTTCTCGATGCATATAAGCACATAAATGCGCACACACAAACACAGGCTGCAGATTACAGAAGCAGCCCC

TAGATCCTTTCCAGGGCACCCACAGAAAACCACAGCACCCGCTGGCCCCAGGGGGAGGAGGCACTTTCAGCCTCTGGCTCACTCGAATGTCAGAGCTTAG

ATGAGGGTGCACCTTTGGTTTGGATTCTGTAGAAGCCATGAGTGAGGTGGGAAGTGTTTTCCAGGGTTGTTGCCACGCCCTGGGTAAGTAACACCTCTGA

GGATTCTCAGAAGCACACTTGAGATCTGAGGAACGCTGCTCTCATGTAGTAATCATCTATTCCCAAAGGGCCCCCTGCAGTAGTCAAAACTATTTGTTTA

TCCCCCCAAATCCTATCTTTACAAATGGTGCTGATGAGATTACAACCCCTCTGTGTACTAATCAGCTTATCAACCAAGTGAGAACCTAGGAAAGCTAATT

GGATGGCAGACTGCTTAAATCGCAGGGAGGACTCAGAAGCCAAACCTACTTCCGTTCGTTTCATTATCTGCAACTTTAGAAAGAAATGATCTTTTTTTCC

CCCTGAAAAGATAACAAAGTCTGCAATTTGGTTTGGAGTATTCCTACTGCAGCCTGGAAGTTTAGCTTCACTGTGAATTTAACAGAGAAAGTGCCTATAA

AGGGGGCGTTTTTAAGAGACAATCCCATGATGCTGCGCCAATGCTAACAACAGGGTCAAGAAACACAATGTTTATAGAAGGAGCATCCCTCGACCATCTG

AATGAGAGTATGCCTGACCCCTTCCACCACAAGTGGGGACACCTCTGCATATCTGCTCCCTCCTCTGCTGTTAAGCCCCAGGGAGCCCCATCCACCCAGT

GGTCCTACAGACAGGGCAATACACACACACCAAGATAGCCTTCAGATCAACATGCATCACACTCAAGTGTTAATCTTTCAAGGTTTTCTTTTCTTTTTCC

TGTTTTTTATTTGTTTTGCTTTTGCTTTTTTTTTTTTTTTTTTTTTGGTGGTGGTGGGGCTACCAAACTTGAGGCCTAGAGCTAAAAATCATATAGAAAT

GATGTTATCTTGTGGTGTGAGGAAAGGCCAGCTGGCCTAAGTTCACACTTTTGTCCCAGTGGCCCTAGACTCCACCCAGCCAGCTCCCAAAATGAAAAGA

CCACCTGTCAAGCAGCAGTCAGGAGTCTGATGTCACCCATCACTATTTTTTTTCCATCATTGTGCTTGCCTCTGCCTCCTTCCACACCCGTGTGACGTAA

TCGCATTGGGAAGCCAGGACAATGTTTGCTGTTCTGCTTTGGGTAAAGGGACTCCCTGAAGCTCTGTGGCTCTCCAGTATGGTCCCTTTTCCTTCCTAAC

AGATGCATATGTTTTCTTCAGAATACAATAGTGATTCTTAAAATAACCCAAAAGACAGGCATCCACAGTGTGTGAGCATGAATCACAGCCTGCATTGTGT

GAGTGTGAATAGTGGGATAAAAGTGGATGTCAGAAGAGTGGAAATCAAACCTCTGCAAAGCAATCTTTCTCTTTCTGTGAAGTGTATTAAGAAATACCTG

AAGTCTGTGTGTGTGGTGGTACCCAGACTGTCAATCAATAAAGACCCAGACTGTCAATGAAA
Translation
LVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQ - UNI32859 - NCDLEQQSIVHIVQRPRRRSHETNASGGDE

PQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPV VKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQ GPSCWDD

VLIPNRMSGECQSPDCPGTRA EFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVR - UNI30806 - RSPVLVFQCNHRHVICLDCFHLYCV

TRLNDRQFVHDAQLGYSLPCVA AGCPNSLIKELHHFRILGEEQ YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG - UN

I32036 - FVFCRDCKEAYHEGDCDSLLEPSGATSQ - UNI32248 - AYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNG GGCMHMKC

PQPQCKLEWCWNCGCEWNRACMGDHWFDV

For any suggestions or comments, please send an email to unitrap@crg.es