Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023830 (Igf2r)
Chromosomal location
Chr 17: 12875279 - 12962530 (-)
Description
insulin-like growth factor 2 receptor Gene [Source:MGI Symbol;Acc:MGI:96435]
RefSeq_dna
NM_010515 
RefSeq_peptide
NP_034645.2 
UniGene
Mm.26553 Mm.473474 
MGI
MGI:96435 
Uniprot/SWISSPROT
Q07113 
Uniprot/SPTREMBL
Q7TMR1 Q80VF2 Q8C2F9 Q8C6V9 Q8K0J1 
Human Ortholog
ENSG00000197081 (IGF2R)
Omim not available
UniTrap UNI10246
Vector Insertion
Chr 17: 12933273 - 12941509
Public Clones GST182 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9823
Vector Insertion
Chr 17: 12909583 - 12910138
Public Clones XST197 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9894
Vector Insertion
Chr 17: 12902441 - 12903502
Public Clones RST317 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9149
Vector Insertion
Chr 17: 12881370 - 12881855
Public Clones RST408 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024599
Sequence
CCCTGGCTCCAGTTCTCTCTCCTCTTTCTCCCTCCAGCTCCCGTTGCAGCTTCGACTCCGCTGTGGTGGCGCGACCGTGTCCCAGGCGCGGCTCCAAACG

GCCAGCCGCCGTGAGCCCCACGCCACACGCGATGCGGGCCGTTCAGCTGGGACCGGTGCCCTCCGGGCCGCGCGTCGCGCTCCTGCCGCCGCTCCTGCTG

CTGCTGCTCCTGGCGGCCGCGGGCTCCGCGCAGGCCCAGGCCGTCGACTTGGACGCCCTGTGCAG TTACACATGGGAAGCTGTTGACTCCAAAAACAAT

GCAGTTTATAAGATCAACGTCTGTGGAAATGTGGGTATTTCCAGCTGTGGGCCTACAAGTGCTATCTGTATGTGTGACCTAAAGACAGAGAACTGCCGCT

CAGTGG - UNI10246 - GTGACTCACTTTTGAGAAGTTCAGCCAGATCACTCCTGGAATTCAACACCACTATGGGCTGCCAGCCTTCAGATTCACAG

CACAGAATCCAGACTAGCATTACATTTCTGTGTGGGAAGACCCTG GGAACTCCTGAATTTGTAACTGCCACAGACTGTGTGCATTACTTTGAATGGAGG

ACTACTGCAGCCTGCAAGAAAGACATATTTAAAGCTGATAAGGAG GTACCATGCTATGCATTTGATGACAAGTTACAGAAGCATGATTTAAACCCACTG

ATCAAGCTAAATGGTGGCTATCTGGTAGATGATTCTGATCCTGACACGTCTCTGTTCATCAACGTGTGTAGAGACATAG ACTCCCTTCGGGACCCCAGC

ACACAGCTGAGAGTCTGTCCTGCTGGCACTGCTGCCTGTCTGCTGAAGGGGAACCAGGCATTTGACGTTGGCCGACCCAAGGAGGGGCTGAAGCTGTTGA

GCAAGGACAG GCTCGTTCTGACTTATGTGAAGGAAGAGGGAGAAAAGCCAGACTTCTGTAATGGTCACAGCCCTGCAGTGACAGTAACATTTGTGTGCC

CATCTGAGCGGAGAGAG GGTACCATTCCTAAACTCACTGCCAAGTCCAACTGCCGTTATGAAGTTGAGTGGATCACCGAGTATGCCTGCCACAGAGATT

ACCTGCAAAGTGAGAGCTGCTCCCTCAGCAGTGAGCAGCATGATATTACTATTGACCTTAGTCCCTTGGCCCAATATGGAG GGTCCCCCTATGTTTCTG

ATGGAAGAGAATATACGTTTTTTATCAATGTCTGTGGGGACACAAAGGTCTCACTCTGTAATAACAAAGAGGCTGCTGTTTGTCAAGAGAAAAAGGCGGA

TTCCACTCAAGTCAAAATAGCAGGAAGACACCAGAACCAGACACTCCG GTACTCAGATGGAGACCTCACCCTCATCTATTCTGGAGGTGATGAGTGTAG

CTCTGGCTTCCAGAGGATGAGTGTCATAAACTTTGAGTGCAACAAAACTGCAG GTAAGGATGGGAGAGGAGAGCCTGTGTTCACAGGTGAGGTGGACTG

CACCTACTTCTTCACATGGGACACTAAATACGCCTGCATCAAAGAGAAGGAAGACCTCCTCTGCGGGGCCATCAATGGCAAGAAACGCTATGACCTGTCT

GTGTTGGCTCGTCACTCAG AATCAGAACAGAATTGGGAAGCAGTGGATGGCAGCCAGGCAGAATCAGAAAAGTATTTCTTCATCAACGTCTGTCACCGG

GTGCTGCAGGAGGGGAAGGCCAGGAACTGTCCTGAAGATGCTGCTGTGTGCGCTGTGG ATAAGAATGGGAGTAAAAACCTTGGAAAATTTGTCTCTTCT

CCTACAAAAGAGAAAGGACACATACAGCTCTCTTACACTGATGGTGATGACTGTGGCAGTGATAAGAAAATATCAACTAACATCACACTTGTGTGCAAAC

CAG GTGATCTAGAAAGTGCTCCAGTGCTAAGAGCTGCAAGATCTGATGGCTGCTTCTATGAGTTTGAGTGGCATACGGCTGCTGCCTGTGTACTGTCGA

AGACAGAAGGAGAGAACTGCACGGTCCTTGATGCCCAGGCAG - UNI9823 - GGTTTTCCTTTGATTTGTCACTCCTCACGAAGAAGAATGGTGCAT

ATAAAGTTGAGACAGAGAAGTATGACTTCTACATAAATGTTTGTGGCCCTGTATCCATGGATCCTTGTCAGTCAAACTCGGGGGCCTGCCAGGTAGCGAA

AAG TGGTAAGTCTTGGAACTTGGGGCTGAGTAGTACTAAGCTCACCTACTACGACGGAATGATCCAGCTGAGCTACAGGAACGGCACTCCCTATAACAA

TGAAAAGCACACACCGAGAGCCACACTGATTACCTTCCTCTGTGACCGTGACGCTGGAGTGGGCTTCCCAGAATATCAG GAAGAGGACAACTCTACCTA

CAACTTCCGGTGGTACACCAGTTATGCCTGCCCAGAAGAACCCCTGGAGTGCATGGTGACAGACCCCTCCATGATGGAACAGTATGACCTCTCCAG TCT

AGTGAAGTCTGAAGGTGGCTCTGGAGGAAACTGGTATGCTATGGAAAACTCCCGGGAACATGTTACACGGAGGAAATACTACCTCAATGTGTGTCGGCCT

CTGAATCCTGTGCCAGGCTGCGATCGATATGCATCTGCTTGCCAGATGAAATATGAAAATCATGAG GGCTCCTTGGCAGAGACTGTATCCATCAGTAAC

TTGGGAGTTGCAAAGATAGGCCCTGTGGTGGAGGAGAGTGGCAGCCTCCTCTTAGAGTATGTGAACGGCTCTGCTTGCACCACCAGTGATGGCCAGCTCA

CCACCTACAGCACCAGGATCCATCTTGTCTGTGGTCGAGGATTTATG AACTCCCATCCCATATTCACTTTCAACTGGGAATGTGTGGTCAGTTTCTTGT

GGAACACGGAGGCTGCCTGCCCTATCCAGACAATCACAGAAACAGACCAG GCTTGCTCAATAAGGGACCCCAGCAGTGGGTTTGTGTTTAATCTTAGCC

CACTCAACGATTCTGCTCAAGGACATGTGGTCTTAGGCATCGGAAAGACTTTTGTG - UNI9894 - TTCAATATCTGTGGTGCAATGCCTGCCTGTG

GAACGGTTGCGGGGAAGCCAGCCTATGGCTGCGAGGCCGAAACTCAGATAGAAGATATTAAGGACCTAAGGCCACAAAGGCCGGTCGGGATGGAGAGGAG

CCTCCAGTTGTCTGCCGAGGGATTCCTCACTCTGACCTACAAGGGCTCTTCTCCCTCTGACAGAG GCACAGCATTCATCATCCGTTTTATTTGCAACGA

TGACATTTACCCAGGAGCCCCCAAATTCCTGCATCAGGACATTGACTCCACACGAGGGATCCGGAACACTTACTTTGAGTTTGAAACTGCATTGGCTTGT

ACTCCTTCTCTAGTGGATTGTCAAGTGACTG ACCCAGCTGGGAACGAGTATGACTTGAGCGCCCTGAGCATGGTCAGGAAGCCATGGACTGCCGTGGAC

ACGTCTGCATACGGGAAGAGGAGGCACTTCTACCTGAGTGTCTGCAACCCTCTGCCTTATATCCCTGGCTGCCACG GCATTGCATTGGGGTCCTGCATG

GTGTCAGAAGACAACAGTTTTAACTTGGGTGTGGTGCAGATCAGTCCTCAAGCTACTGGAAATGGGTCTCTCAGCATCCTGTACGTGAATGGGGACAGAT

GTGGGGACCAGCGCTTCTCCACCAGGATCGTGTTCGAGTGTGCCCAGACGTCG GGCTCACCTATGTTCCAGTTCGTGAACAACTGTGAGTATGTGTTTG

TGTGGCGAACAGTGGAGGCCTGCCCTGTGATCAGAGAGGAAG GAGACAACTGCCAGGTGAAGGACCCCAGGCATGGCAATTTGTATGACCTGAAGCCCC

TGGGCCTCAATGACACCATCGTCAGTGTTGGCGAGTACACCTACTACTTGCGGGTCTGCGGGAAGCTGTCATCAGATGTCTGCTCTGCCCATGACGGATC

CAAGGCAGTCTCATCATGCCAGGAAAAGAAAGGACCACAGGGATTCCAGAAAGTGGCAG GACTCCTTAGCCAGAAGCTGACTTTCGAAAACGGACTGTT

GAAAATGAACTATACTGGGGGGGATACCTGCCATAAGGTGTATCAGCGCTCCACAACCATCTATTTCTACTGTGACCGGACTACACAGAAG CCAGTGTT

TCTGAAGGAAACTTCGGACTGCTCCTATATGTTTGAGTGGCGAACACAGTATGCCTGCCCACCTTTCAATGTGACAGAGTGTTCTGTCCA GGATGCGGC

TGGCAACTCCATTGACCTCTCCTCACTGTCAAGGTACAGTGACAACTGGGAGGCTGTGACCAGGACAGGGGCCACTGAGCATTACCTCATCAATGTATGC

AAGTCTCTGTCTCCACACGCTGGCACAG AGCCATGCCCTCCAGAGGCAGCTGTTTGTCTGCTGAATGGCTCTAAGCCTGTGAACCTTGGCAAGGTGAGG

GATGGCCCTCAGTGGACAGACGGTGTGACTGTCCTGCAGTATGTGGATGGTGACTTGTGCCCAGACAAAATTCGGAGAAGGTCAACCATTATTCGCTTCA

CCTGCAGTGACAACCAAGTG AACTCCAGGCCCCTTTTCATCAGTGCTGTTCAGGACTGTGAGTACACCTTCTCCTGGCCCACCCCTTCTGCCTGTCCTG

TGAAGAGCAACACACATGATGACTGCCAAGTCACCAACCCCAGCACAG GCCACCTGTTTGACCTGAGCTCCTTAAGTGGCAGAGCTGGTATCAATGCCT

CCTACAGCGAGAAGGGGCTGGTCTTCATGAGCATCTGTGAGGAGAATGAGAACTGTGGCCCCGGAGTAG GGGCCTGCTTTGGACAGACGAGGATCAGTG

TGGGCAAGGCCAGCAAGAGGCTGAGCTACAAGGACCAAGTCCTGCAGCTGGTGTATGAGAATGGGTCCCCATGCCCTTCCCTGTCAGACCTGAGGTACAA

GAGTGTCATCAGCTTTGTGTGCCGGCCTGAGGCTGGACCTACCAACAGGCCGATGCTCATCTCCTTGGACAAGCAGACGTGCACACTCTTCTTCTCCTGG

CACACACCCCTGGCCTGTGAGCAAGCG ACGGAGTGTACTGTGCGGAATGGAAGCTCGATTATTGACCTGTCCCCTCTCATCCACCGCACTGGTGGCTAC

GAAGCATACGATGAAAGTGAGGATGACACCTCTGACACCACCCCTGACTTCTATATCAACATCTGCCAGCCACTGAATCCCATGCACGGAGTGCCCTGCC

CTGCAGGTGCCTCAGTATGCAAAGTTCCTGTGGACGGGCCCCCTATA GATATTGGCAGAGTCACAGGCCCTCCAATATTCAATCCTGTGGCGAATGAAG

TCTACCTGAACTTTGAGAGCAGCACTCATTGCTTAGCCGACAGATATATGAACTACACCTCACTCATCACATTTCACTGCAAGAGAGGAGTCAGCATG G

GAACTCCTAAGCTGATAAGGACCAATGACTGCGACTTTGTGTTTGAGTGGGAGACTCCGATTGTCTGTCCTGACGAAGTGAAGACACAGGGTTGTGCTGT

AACAGATGAGCAGCTGCTCTATAGCTTCAACCTGACCAGCCTTTCCACAAGCACTTTCAAG GTTACTCGGGATGCCCGCACATACAGTATAGGGGTGTG

CACAGCAGCAGCTGGCTTAGGCCAGGAAGGCTGCAAGGATGGCGGTGTCTGTCTGCTCTCTGGGAACAAAGGAGCTTCTTTTGGGCGCCTTGCATCGATG

CAGCTGGATTACAGGCACCAAGATGAAGCAGTCATTCTGAGTTATGTGAATGGTGATCCTTGCCCTCCAG AAACGGATGATGGCGAGCCCTGTGTCTTC

CCCTTCATTTACAAAGGGAAGAGCTATGATGAATGTGTATTAGAGGGACGAGCGAAACTGTGGTGTAGCAAAACTGCAAATTATGATCGTGACCACGAGT

GGGGCTTCTGCAGACAGA CCAACAGCTACCGGATGTCTGCGATCATATTTACGTGTGATGAAAGTGAAGATATTGGGAGACCACAAGTGTTCAGTGAAG

ATCGTGGGTGTGAGGTGACATTTGAGTGGAAGACAAAAGTTGTCTGCCCTCCAAAGAAGATGGAGTGCAAGTTTGTTCAGAAGCATAAGACCTATGACTT

GCGACTGCTCTCATCCCTCACGGGGTCCTGGGACTTTGTGCATGAAGGAAACTC GTACTTTATCAATCTGTGCCAAAGAGTATACAAAGGTCCCCTGGA

CTGCTCTGAAAGAGCCAGCATTTGCAAGAAGAGTGCCACTGGTCAAGTCCAGGTTTTGGGGCTTGTTCATACACAAAAATTGGAAGTCATAG ATGAAAC

GGTCATTGTTACTTACTCGAAAGGCTATCCTTGTGGTGGGAATAAGACTGCATCGTCTGTAATCGAATTGACCTGTGCGAAGACTGTGGGCAGGCCTGCA

TTCAAGAG GTTTGACAGTGTCAGCTGCACCTACTACTTTTACTGGTACTCACGGGCTGCCTGCGCGGTGAGGCCTCAGGAGGTGACCATGGTGAACGGA

ACGCTCACCAACCCTGTGACCGGCAAGAGCTTCAGCCTCGGCGAGATTTATTTTAA - UNI9149 - GCTCTTCAGCGCCTCTGGAGACATGAGGACC

AATGGGGACAACTACCTGTATGAAATCCAGCTCTCCTCCATCACCAGCTCTTCTTACCCTGCATGCGCTGGTGCCAACATCTGCCAGGTGAAGCCCAATG

ACCAGCATTTCAGCAGGAAAGTAGGCACCTCTGACATGACCAAGTACTACGTCCAAG ATGGAGATCTGGATGTGGTGTTTACCTCTTCCTCCAAGTGTG

GGAAAGATAAGACCAAGTCTGTTTCTTCCACCATCTTCTTCCACTGTGACCCTCTGGTGAAGGATGGGATCCCAGAGTTCAGCCACGAGACCGCTGACTG

CCAGTACCTGTTCTCCTGGTACACTTCAGCTGTGTGTCCTCTGGG TGTGGACTTTGAGGATGAGAGCGCAGGGCCAGAGTATAAAGGACTCTCAGAGCG

GAGTCAGGCTGTTGGGGCAGTCCTCAGTCTTCTCCTGGTGGCGCTGACTGGCTGCTTGCTGGCCTTACTGCTGCATAAGAAGGAGAGAAG GGAAACTGT

GATAAACAAGCTGACCAGCTGCTGCAGAAGAAGCTCGGGCGTGTCCTACAAGTACTCAAAG GTCAGCAAGGAGGAGGAGACAGATGAGAATGAGACAGA

ATGGCTGATGGAAGAGATCCAGGTGCCAGCCCCAAGACTAGGCAAGGACGGGCAAGAAAATGGCCATATCACCACCAAGGCGGTGAAAGCAGAAGCTCTC

TCGTCCCTGCATGGGGACGACCAGGACAGTGAGGATGAGGTCCTGACCGTTCCAGAGGTGAAAGTTCACTCAGGCCGAGGAGCGGAGGTGGAAAGCTCAC

AGCCCCTGAGAAACCCACAGCGCAAGGTCCTGAAGGAAAGGGAGGGTGAGAGGCTGGGGCTGGTCCGAGGTGAGAAGGCCAGAAAAGGGAAGTTCAGACC

CGGACAGCGCAAGCCAACAGCCCCTGCCAAGCTGGTGTCCTTCCATGATGACAGCGACGAAGACCTCTTACACATCTAACTCCGTGGTGCCTACAGAAGA

AGGTGGAGCCATGGACAGCCAAGCACCTCCAACCAAATAAGACTTCAGCTCGATGATGCGTCTGTCATTTTGCCTTTAACAAAACTGCTTCAAAGGGAAG

AGTTTCTGTAATGGGGGAGAGGATGGGGGAGGTGGGCACCACTCCTTCATGATCGTTTACAGTCAATGGAACAAGGTGTTGCTTGAATCGGCCAAAGGGC

GGTACTTCGTGCCCAGGGGTTTGCCCCAAGTCCTCACTTACGATCATAGCTGCTGTGTGCTTCCAACAGGTGCCCAAGCCACATGCATCTCACAACAGAG

GGCTGTGTTTGAAAAAAACCCTTGCTGCTTTAGACCCTACGGGGTGACCATTTATATTTTTAGCATTGTAATTCTCTCCCCTATTTATTGACTTTGACAA

TTACTACTCAGGTTTGCGAAAAAGGAAAAACAAAAACAAAAACAAAACCAGTTTCTTTTGCCAGCAAGGGCATAAGGTGAAGCTGGCCGTCTGCCGGAGC

CGTTGTCCATGGCTCCTGAACTGGTCCTTGATGCACACTTAGTGAGCTGCAGTATTCTATTCTTCGCTTTGCATTTTGTGAGGGCACACACACATGCACA

GGTCCCCGAGTGCCTAGGTTTGGGAAGGCCCACCTGCTCCGTGCCCTACCTCATCTCTGTAGTTGCAGCTCTTTGCACGAATCCCTCTGGGTGTTGCTCT

TGCCAGCTGGTGACTCCCAGCAGCTCACCCAGGCGGGCGTTCGCGCACACGGTGGAGTGGAGGCTCTTGGGGAGGAGCTGCGCTTCAGGTTTGAGCTGTA

GGTCTCATCTCTTCAGGGTCTCATAGTGCCACCTTTACTGTGCTTTTTGCTTTTTTTTTTTTTTTTTTTAAGGGGGAAAATGTTTATCACCCATTCGACC

TATAAGAAGCCTTAATTTGCACAGGGTGACTTATTACAGACACCGTGAAACGCGGTGGGCCAGTGTTGGTGTAGGGCCAGTGTTGGTGTAGGGGCTGTGC

TAGGGCAGTGTCCCAGGATGGAAGGGCAGGCCCAGTCCACTGGCTGTGGATTCTTTTCTTGATGTGTTCAGTGACTTGTCACATTATAGAGTTGTATATA

GGTGGCATTTACATACCCAAAAGCAAAGTACCCCGCAGAATTTCTTGGTTTATGCCTGATTTTGCTAGCTTATTTGATTTCACATTGAGTGTATTTTTAA

AAATTGATTTTTCTCTTCATTTTTAATCAACTTGACTGTAATATGAAGTATTCAATTTCAATAAAGATAAATTATT
Translation
MRAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCS SYTWEAVDSKNNAVYKINVCGNVGISSCGPTSAICMCDLKTENCRSVG - UNI

10246 - GDSLLRSSARSLLEFNTTMGCQPSDSQHRIQTSITFLCGKTL GTPEFVTATDCVHYFEWRTTAACKKDIFKADKE VPCYAFDDKLQKHDL

NPLIKLNGGYLVDDSDPDTSLFINVCRDID DSLRDPSTQLRVCPAGTAACLLKGNQAFDVGRPKEGLKLLSKDR RLVLTYVKEEGEKPDFCNGHSPAV

TVTFVCPSERRE GTIPKLTAKSNCRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLAQYGG GSPYVSDGREYTFFINVCGDTKVSLCNNKEA

AVCQEKKADSTQVKIAGRHQNQTLR RYSDGDLTLIYSGGDECSSGFQRMSVINFECNKTAG GKDGRGEPVFTGEVDCTYFFTWDTKYACIKEKEDLLC

GAINGKKRYDLSVLARHSE ESEQNWEAVDGSQAESEKYFFINVCHRVLQEGKARNCPEDAAVCAVD DKNGSKNLGKFVSSPTKEKGHIQLSYTDGDDC

GSDKKISTNITLVCKPG GDLESAPVLRAARSDGCFYEFEWHTAAACVLSKTEGENCTVLDAQAG - UNI9823 - GFSFDLSLLTKKNGAYKVETEK

YDFYINVCGPVSMDPCQSNSGACQVAKS SGKSWNLGLSSTKLTYYDGMIQLSYRNGTPYNNEKHTPRATLITFLCDRDAGVGFPEYQ EEDNSTYNFRW

YTSYACPEEPLECMVTDPSMMEQYDLSS SLVKSEGGSGGNWYAMENSREHVTRRKYYLNVCRPLNPVPGCDRYASACQMKYENHE GSLAETVSISNLG

VAKIGPVVEESGSLLLEYVNGSACTTSDGQLTTYSTRIHLVCGRGFM NSHPIFTFNWECVVSFLWNTEAACPIQTITETDQ ACSIRDPSSGFVFNLSP

LNDSAQGHVVLGIGKTFV - UNI9894 - FNICGAMPACGTVAGKPAYGCEAETQIEDIKDLRPQRPVGMERSLQLSAEGFLTLTYKGSSPSDRG GT

AFIIRFICNDDIYPGAPKFLHQDIDSTRGIRNTYFEFETALACTPSLVDCQVTD DPAGNEYDLSALSMVRKPWTAVDTSAYGKRRHFYLSVCNPLPYIP

GCHG GIALGSCMVSEDNSFNLGVVQISPQATGNGSLSILYVNGDRCGDQRFSTRIVFECAQTS GSPMFQFVNNCEYVFVWRTVEACPVIREEG GDNC

QVKDPRHGNLYDLKPLGLNDTIVSVGEYTYYLRVCGKLSSDVCSAHDGSKAVSSCQEKKGPQGFQKVAG GLLSQKLTFENGLLKMNYTGGDTCHKVYQR

STTIYFYCDRTTQK PVFLKETSDCSYMFEWRTQYACPPFNVTECSVQ QDAAGNSIDLSSLSRYSDNWEAVTRTGATEHYLINVCKSLSPHAGTE EPC

PPEAAVCLLNGSKPVNLGKVRDGPQWTDGVTVLQYVDGDLCPDKIRRRSTIIRFTCSDNQV NSRPLFISAVQDCEYTFSWPTPSACPVKSNTHDDCQVT

NPSTG GHLFDLSSLSGRAGINASYSEKGLVFMSICEENENCGPGVG GACFGQTRISVGKASKRLSYKDQVLQLVYENGSPCPSLSDLRYKSVISFVCR

PEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQA TECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTTPDFYINICQPLNPMHGVPCPAGASVCK

VPVDGPPI DIGRVTGPPIFNPVANEVYLNFESSTHCLADRYMNYTSLITFHCKRGVSM GTPKLIRTNDCDFVFEWETPIVCPDEVKTQGCAVTDEQLL

YSFNLTSLSTSTFK VTRDARTYSIGVCTAAAGLGQEGCKDGGVCLLSGNKGASFGRLASMQLDYRHQDEAVILSYVNGDPCPPE ETDDGEPCVFPFIY

KGKSYDECVLEGRAKLWCSKTANYDRDHEWGFCRQT TNSYRMSAIIFTCDESEDIGRPQVFSEDRGCEVTFEWKTKVVCPPKKMECKFVQKHKTYDLRL

LSSLTGSWDFVHEGNS SYFINLCQRVYKGPLDCSERASICKKSATGQVQVLGLVHTQKLEVID DETVIVTYSKGYPCGGNKTASSVIELTCAKTVGRP

AFKR RFDSVSCTYYFYWYSRAACAVRPQEVTMVNGTLTNPVTGKSFSLGEIYFK - UNI9149 - KLFSASGDMRTNGDNYLYEIQLSSITSSSYPA

CAGANICQVKPNDQHFSRKVGTSDMTKYYVQD DGDLDVVFTSSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSWYTSAVCPLG GVD

FEDESAGPEYKGLSERSQAVGAVLSLLLVALTGCLLALLLHKKERR RETVINKLTSCCRRSSGVSYKYSK VSKEEETDENETEWLMEEIQVPAPRLGK

DGQENGHITTKAVKAEALSSLHGDDQDSEDEVLTVPEVKVHSGRGAEVESSQPLRNPQRKVLKEREGERLGLVRGEKARKGKFRPGQRKPTAPAKLVSFH

DDSDEDLLHI

For any suggestions or comments, please send an email to unitrap@crg.es