Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023882 (Zfp54)
Chromosomal location
Chr 17: 21560191 - 21572348 (+)
Description
zinc finger protein 54 Gene [Source:MGI Symbol;Acc:MGI:99201]
RefSeq_dna
NM_011760 
RefSeq_peptide
NP_035890.2 
UniGene
Mm.438999 
MGI
MGI:99201 
Uniprot/SPTREMBL
Q66JT2 Q9QWM9 O88631 Q6R5P4 
Human Ortholog
ENSG00000198633 (AC010320.10)
Omim not available
UniTrap UNI35076
Vector Insertion
Chr 17: 21560526 - 21564700
Public Clones IST11717A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5089
Vector Insertion
Chr 17: 21567286 - 21570366
Public Clones YTC632 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115548
Sequence
GAGGAAGTGTGTTGTGTGGAGGAAGTGTGTTGAATGGAGCTGGGATTAGAGGAGTGGCGTGATAGCTGGGACTGTTCTTTAGTGAACCTAGGTAAGTTGA

CTGAGGAGCCAAACCCAAAAGTGGCAAGGACGTCTTCCTCGAGGAACTCGCTGGCATGCACCGTGGAGAATCTTGTGATGCAGACCTGGAGTCAGAGGAT

ACAAGAAGGGTTTCAAGGGGACGCAAAAAACTACCCTGAGCCTCAGGTGCCGCGCGGGGCATCCTGGGAGAGTCAGCAGGCAGCAGCCCAACCGGTGGAA

CCACAGCCCAGTGGGGGAGGGCTGTAACCTACCAG - UNI35076 - GTCCACTTGTCATCTATTCATTATTCTTCAAAGAGAAATTCAAAGAAGAGA

AACAACAAGAAATGGCTGATTCTTCAGTCAACTTGTCCCAG GGTCTGTTGACATTCCGGGATGTGACTGTGGACTTCTCCCAGGAGGAGTGGGAATGCC

TGGACTCTGCTCAGAGGGCTCTGTACATTGAAGTGATGTTGGAGAATTACAGCAACCTGGTATATGTCG - UNI5089 - AGAACTACTGCATATGTG

ATACAGTCTGTCAACATGTGAAGACTGAAAAGGAGTCTTGTAATGAGCTTGGTGAAATGCTTCATGAACCCTCCAACTGTGCCCTTTATAATAGAAGCGA

CACTACAGAAGCCTCTAACAACTACAGATGCTGTAAGGACCAGGATGCCTCTCTTGACTCATCAAACCCAGATAGACTTAAAAGCACGCACACTGGAAAA

GAACGTTGTGAATCTAAAGACTGTGCGAAATCTTCCAGTTTGTGTTCCAGCATTGCTCAAGATCAGAGAACAAACAGTACAAACAAAGAACAGAGACAGG

AAAAATATGATGACCATTTCATCTCTACACACAGTCTCATGCAACAAGCAATCTATATTGGAGAGAATCCACACCAGTGTATGAAATATGGGAAATGTTT

CAGTAGTGCCTCAAGCCTCGGGGTACAGCAGAGAACTGATACTGGAAACAAACCCTACAAGTGCAATATTTGTGACAAATCCTTTACTGAGTGCTCAAGT

CTTAAAGAACATCGAAAAACACATCAAAGACTTCGTGCTGGAACAAACCCTTACAAATGCAATGACTGTGGAAAGTCATTTTCATATTTGTCTGCACTTC

AAAGTCATCATAAAAGGCATACTGGAGAGAAGAGGTACAAATGTAAAGAATGTGGCAAATCCTATGCCTACCGTACTGGTCTGAAGAGACATCAGAAAAT

CCATACTGCAGAGGAATGTTATAGTTGTCAATACTGTGGCAAGGTCTTTCATCAGCTTTCACACTTTAAAAGTCATTTCACACTCCATACTGGAGAGAAG

CCTTACAAATGCAATGAGTGTCACAGATCTTTTCCCCACTATGTATTCTTTAGAAGGCATAAGAAAAATCATTCTCTACAGAAATCACACAAATGCAAAG

AGTGTGGTAAGTCCTTTTTTATATTATCACATCTTAAAACTCATTACAGAATCCATACTGGTGAGAAGCCTTACAAATGTACAAAATGTGACAAACTCTT

TACACAGTACTCACATCTTCGAAGACATCAAAGAATTTATACTGGAAAGAAACTTTATAGATGTGAGGTATGTGACAAATGGTTTACTCTGTCCTCAAGT

CTCAGCAGACATCAGAAAATCCATACTGAAGCAAAAACTTACAAATGCAAGGACTGTGACATATTCTTTAACCACTACTCAAGTCTTAGAAGACATCAGA

AGGTTCATACTGGAGAAAGACATTATACGTGTAAACAGTGTGGCAAGTCTTTTACTAGGGGCTCAACTCTTAGAGTACATCAGAGAATTCATACTGGAGA

AAAACCTTACAAATGTAGTGAATGTGACAAATCATTTACCCAGGCCTCACAACTTAGAACACATCAGAGAGTTCATACTGGAGAGAAACCTTATGTATGT

AAGGAATGTGGCAAATCACTTACTACATGTGCAATTCTTAGAGCACATCAGAAAATTCATACTGGAGAAAAACCTTACAAATGTATGGAATGTGACAGAT

CCTATATCCAATACTCACATCTTAAAAGACATCAGAAAGTTCATACTGGAGAGAAACATAAAATTGTAAATAATGTGACATAGCATTCATCCAGTATTCT

CTCTGTGTTCAAATCCCAACATTATACATAATAGAAATATATGCATGAGAGACAGGGGAAAGCCTTTAATAAAGTTTTAAATCTTACAATTTATCACAAA

GTTTGTCAAAATAAATTCCAAATGTGATTATATGAAAACCGTTTTGTTTTCTTTTTTTCTTTTGTGTGTGTGGATGCTTATATGTGTGCACTTTGCTGCT

TACATCTCTGTGCACTACATGTATGCCTGGTGCCTATGGAGGCCAGATCCCCTGAAGCTGGACTTAATGACAGTTGTGAGCTGTTATATGTATGTTGGAA

ATTGAACCCTAATACATTCTAAGAACAGATGTTGCTTTTAACCTCTAGATGGTGCTTTTATCCT
Translation
 - UNI35076 - MADSSVNLSQ GLLTFRDVTVDFSQEEWECLDSAQRALYIEVMLENYSNLVYVE - UNI5089 - ENYCICDTVCQHVKTEKES

CNELGEMLHEPSNCALYNRSDTTEASNNYRCCKDQDASLDSSNPDRLKSTHTGKERCESKDCAKSSSLCSSIAQDQRTNSTNKEQRQEKYDDHFISTHSL

MQQAIYIGENPHQCMKYGKCFSSASSLGVQQRTDTGNKPYKCNICDKSFTECSSLKEHRKTHQRLRAGTNPYKCNDCGKSFSYLSALQSHHKRHTGEKRY

KCKECGKSYAYRTGLKRHQKIHTAEECYSCQYCGKVFHQLSHFKSHFTLHTGEKPYKCNECHRSFPHYVFFRRHKKNHSLQKSHKCKECGKSFFILSHLK

THYRIHTGEKPYKCTKCDKLFTQYSHLRRHQRIYTGKKLYRCEVCDKWFTLSSSLSRHQKIHTEAKTYKCKDCDIFFNHYSSLRRHQKVHTGERHYTCKQ

CGKSFTRGSTLRVHQRIHTGEKPYKCSECDKSFTQASQLRTHQRVHTGEKPYVCKECGKSLTTCAILRAHQKIHTGEKPYKCMECDRSYIQYSHLKRHQK

VHTGEKHKIVNNVT
Transcript ENSMUST00000007884
Sequence
ATGCACCGTGGAGAATCTTGTGATGCAGACCTGGAGTCAGAGGATACAAGAAGGGTTTCAAGGGGACGC AAAAACTACCCTGAGCCTCAG TGCCGCGC

GGGGCATCCTGGGAGAGTCAGCAGGCAGCAGCCCAACCGGTGGAACCACAGCCCAGTGGGGGAGGGCTGTAACCTACCAG - UNI35076 - GTCCAC

TTGTCATCTATTCATTATTCTTCAAAGAGAAATTCAAAGAAGAGAAACAACAAGAAATGGCTGATTCTTCAGTCAACTTGTCCCAG GGTCTGTTGACAT

TCCGGGATGTGACTGTGGACTTCTCCCAGGAGGAGTGGGAATGCCTGGACTCTGCTCAGAGGGCTCTGTACATTGAAGTGATGTTGGAGAATTACAGCAA

CCTGGTATATGTCG - UNI5089 - AGAACTACTGCATATGTGATACAGTCTGTCAACATGTGAAGACTGAAAAGGAGTCTTGTAATGAGCTTGGTGA

AATGCTTCATGAACCCTCCAACTGTGCCCTTTATAATAGAAGCGACACTACAGAAGCCTCTAACAACTACAGATGCTGTAAGGACCAGGATGCCTCTCTT

GACTCATCAAACCCAGATAGACTTAAAAGCACGCACACTGGAAAAGAACGTTGTGAATCTAAAGACTGTGCGAAATCTTCCAGTTTGTGTTCCAGCATTG

CTCAAGATCAGAGAACAAACAGTACAAACAAAGAACAGAGACAGGAAAAATATGATGACCATTTCATCTCTACACACAGTCTCATGCAACAAGCAATCTA

TATTGGAGAGAATCCACACCAGTGTATGAAATATGGGAAATGTTTCAGTAGTGCCTCAAGCCTCGGGGTACAGCAGAGAACTGATACTGGAAACAAACCC

TACAAGTGCAATATTTGTGACAAATCCTTTACTGAGTGCTCAAGTCTTAAAGAACATCGAAAAACACATCAAAGACTTCGTGCTGGAACAAACCCTTACA

AATGCAATGACTGTGGAAAGTCATTTTCATATTTGTCTGCACTTCAAAGTCATCATAAAAGGCATACTGGAGAGAAGAGGTACAAATGTAAAGAATGTGG

CAAATCCTATGCCTACCGTACTGGTCTGAAGAGACATCAGAAAATCCATACTGCAGAGGAATGTTATAGTTGTCAATACTGTGGCAAGGTCTTTCATCAG

CTTTCACACTTTAAAAGTCATTTCACACTCCATACTGGAGAGAAGCCTTACAAATGCAATGAGTGTCACAGATCTTTTCCCCACTATGTATTCTTTAGAA

GGCATAAGAAAAATCATTCTCTACAGAAATCACACAAATGCAAAGAGTGTGGTAAGTCCTTTTTTATATTATCACATCTTAAAACTCATTACAGAATCCA

TACTGGTGAGAAGCCTTACAAATGTACAAAATGTGACAAACTCTTTACACAGTACTCACATCTTCGAAGACATCAAAGAATTTATACTGGAAAGAAACTT

TATAGATGTGAGGTATGTGACAAATGGTTTACTCTGTCCTCAAGTCTCAGCAGACATCAGAAAATCCATACTGAAGCAAAAACTTACAAATGCAAGGACT

GTGACATATTCTTTAACCACTACTCAAGTCTTAGAAGACATCAGAAGGTTCATACTGGAGAAAGACATTATACGTGTAAACAGTGTGGCAAGTCTTTTAC

TAGGGGCTCAACTCTTAGAGTACATCAGAGAATTCATACTGGAGAAAAACCTTACAAATGTAGTGAATGTGACAAATCATTTACCCAGGCCTCACAACTT

AGAACACATCAGAGAGTTCATACTGGAGAGAAACCTTATGTATGTAAGGAATGTGGCAAATCACTTACTACATGTGCAATTCTTAGAGCACATCAGAAAA

TTCATACTGGAGAAAAACCTTACAAATGTATGGAATGTGACAGATCCTATATCCAATACTCACATCTTAAAAGACATCAGAAAGTTCATACTGGAGAGAA

ACATAAAATTGTAAATAATGTGACATAG
Translation
MHRGESCDADLESEDTRRVSRGR KNYPEPQ CRAGHPGRVSRQQPNRWNHSPVGEGCNLPG - UNI35076 - GPLVIYSLFFKEKFKEEKQQEMAD

SSVNLSQ GLLTFRDVTVDFSQEEWECLDSAQRALYIEVMLENYSNLVYVE - UNI5089 - ENYCICDTVCQHVKTEKESCNELGEMLHEPSNCALY

NRSDTTEASNNYRCCKDQDASLDSSNPDRLKSTHTGKERCESKDCAKSSSLCSSIAQDQRTNSTNKEQRQEKYDDHFISTHSLMQQAIYIGENPHQCMKY

GKCFSSASSLGVQQRTDTGNKPYKCNICDKSFTECSSLKEHRKTHQRLRAGTNPYKCNDCGKSFSYLSALQSHHKRHTGEKRYKCKECGKSYAYRTGLKR

HQKIHTAEECYSCQYCGKVFHQLSHFKSHFTLHTGEKPYKCNECHRSFPHYVFFRRHKKNHSLQKSHKCKECGKSFFILSHLKTHYRIHTGEKPYKCTKC

DKLFTQYSHLRRHQRIYTGKKLYRCEVCDKWFTLSSSLSRHQKIHTEAKTYKCKDCDIFFNHYSSLRRHQKVHTGERHYTCKQCGKSFTRGSTLRVHQRI

HTGEKPYKCSECDKSFTQASQLRTHQRVHTGEKPYVCKECGKSLTTCAILRAHQKIHTGEKPYKCMECDRSYIQYSHLKRHQKVHTGEKHKIVNNVT

For any suggestions or comments, please send an email to unitrap@crg.es