Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023903 (Mmp25)
Chromosomal location
Chr 17: 23766425 - 23782236 (-)
Description
matrix metallopeptidase 25 Gene [Source:MGI Symbol;Acc:MGI:2443938]
RefSeq_dna
NM_001033339 
RefSeq_peptide
NP_001028511.1 
MGI
MGI:2443938 
Uniprot/SWISSPROT
Q3U435 
Human Ortholog
ENSG00000008516 (MMP25)
Omim not available
UniTrap UNI17560
Vector Insertion
Chr 17: 23777242 - 23781005
Public Clones not available
Private Clones OST440735 (lexicon) OST320539 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024696
Sequence
AGAGCCCTGCGACAGAGCATGGATCTGGGAACAGAAACTTTTAGACTGAGACGGCGGAGTAGAGGACTTGTCAGCCGGCTTGCCCCACTGTAGCTGGCCC

TTAAGCTCATAGGAGAGTCCCTGCGTGCCGGTGGGGAACAGGGAGAGCCCCTGACCCTCCTCTTGGACACTGACGTTGGAAGATTGGGCTACTTCCCCTA

CCGCGCCCTTAACGCTTCTCTGGGTGAGCCCCGCCTCATCCAGGCTCCCACTAGCATATTGGGCAGTTGGCGCCTCGCCCAGGCTGGACCTGGAGGAGAC

AGGAGTAGGGGACCTCTTTGCCGGACCTCTGTCCCCTCCTGAGCCTTCTCCACGCTCTCAGGACCCCCACTCCCCAGCGCCACCTGGACCCTCGATTATC

GCCGTTCAGCCCGTGATGTGCTTCCCAGGATCCCAGATCTCTCCTGCCCGTCTCTACTACCTTGTGTCGGCTCCCTGGATCTGCACCGGGTCCCTGACCT

CCTCCAGACTTCCACGGCGGCGGGAGTCAGGGCCTCTTCGCGTGCCTCCGCGGTCCGTCCAAGCTGAACGCATCTTGAGGCTGCCGGCTTTCGGTCTCCC

GTTGCTGGCGCTTCTGTTGGTTCCGCTGCTGCCGGTGCGCGCTCAGAATCCCGATGCGAAGGTCGTGAGCATGGGCGTG GAATGGCTGACTCGCTATGG

CTACCTGCCACCGGCGGATCCTGTCCACGCCCAGATGCAGAGTCTTGAGAAACTGCAGGATGCAATCAAAGTCATGCAGAGATTTGCCGGACTACCTGAG

ACTGGACAAATGG - UNI17560 - ACCCAATGACAATAAAGACCATGCGCAAGCCCCGGTGCTCCCTGCCTGATGTCCTGGGCGCAGCTGGGCTGGT

CAGACGCCGACGTCGCTATTCTCTGAGTGGCAGTGTTTGGAAGAAACGCACCCTGACATGGAG TATCCGGTCCTTCTCTCAGAAATCCCAGTTGAGCCC

GCAGATTGTTCGGACCCTCCTGAGCTATGCCCTGGCTGTCTGGGCTACTGAATCAGGCCTTACATTCCAGGAGGTGAATTCTCAGTACCAGGAGCCTGAC

ATCATTATCCACTTTGCTCGGGCCTACCACCAGGACAGTTACCCCTTTGACGGGTCTGGTGGCACGTTGGCTCACGCCTTCTTCCCTGGGGAGCACCCTA

TCTCTGGAGACACGCACTTTGATGATGAAGAGACCTGGACTTTTGGGTCAACAG ATGATAACGGAATTGACCTATTTGCAGTAGCAGTTCATGAATTTG

GCCATGCCCTAGGCCTTGGCCACTCTTCTGCACCCAACTCCATTATGCGGCCCTTCTACCAGGGCCCGGTGGGTGACCCTGCCACATACCGTTTGCCCCA

GGATGACCGTGACGGACTGCAGCAGCTCTATG GGAGAGTGTCCCAAAATCCAAATGCCAGGCCCACAAGGAAACCCCTGGTTCCGCCTCCCCAGCCTCC

AGCCATGCCCCCTGACAG CCCCGCCACACCTGTGCCTGACCGCTGTGAGGGCAACTTTGATGCCGTTGCCAACATTCGAGGGGAAATTTTCCTCTTCAA

AG GCCCATGGTTTTGGCGCCTCCAACCCTCAGGACAGCTGGTATCACCCCGCCCTGCTGGGTTGCACCGCTTTTGGGAGGGGCTGCCAACCCATGTGAA

AGTCATCCAGGCTGCCTATGCCCGACCCCTAGATGGCCGAATCATCCTCTTCAGCG GCCCGCAGTTCTGGGTGTTCCAGGAACGACAGCTTGAGGGTGC

AGCGCGGCCACTGGTAGAGTTTGGGCTGCCCCCAGGAGAAGACGTGGATGCTGTGTTCTCATGGCCTCACAATGGCAAGACATACCTGATCCGAGGTCAA

AAGTACTGGCGGTATGACGAGGTGGCCGCCCGCCCAGACCCTGGCTACCCACGTGCCTTGAGTCTCTGGGATGGGGCGCCCTTTGCCCCAGACGATGTCA

CCATCAGCAACACAG GTGACACTTACTTTTTCAAGGGCACCCATTTCTGGCGCTTTGCGGAGGGCAGTGTCAAAGCTGAGTCAGATTCCCCCCAGCCCA

TTGGGCCCAAGTGGCTGGACTGCCCTGCCCCCAACTCTGACCCTCGAGTCACCAGTCCCCCGAAAACGACATCCAAAACCCGAAGCTGTGATTGTCACTG

CGAGCTCAATCAAGCCTCAGAGCAGCTGTCGCCCCTCCTGCTGCCTCTCCTACCCCTAGTGGCTGGAGAGGTCTTTTCTTACTGAAACCTGGTCCTTCCT

TGTGGACTTCCTATATAAAAGGAAGACGGAGTCTCCCGCAGCGGGGCCTCACCATCTGTGCTCCGCGTCCCTCATCCCACGTGCACAGAGCTGAGAGATT

CCTAGTAGAAGCCCGGGGACGCCTCCAGTGTTACTGAGTCTGCTTTCTGTTAGGGTGCAGGGAGCCGTGGCCATAGTGAGGGTGGCCGCCAGGGGGTGGT

GTGCACCCTCTCCATCGCCAAGAGGGGCGTGCCTGCTGTAGCTACTAGAACTAGAAACCCAGCAGAATTGCAGCTCCTCAAACCAGAATTGCTCCTCCAA

ACCAAGGTGACACTAACACCCAGGTTATGTGCTGCCTTCTGCTGAGCTAACTGGCTTTCTGGGAATCCCCACTCCTCTAATTCTCAACTAGTCCTACTGA

TCACAGTGGGATGGTGACTGTACTCTGACTAGATGCGTTAAACAGGACCAGGACATTGAACCCCAGCATCTCCTTTAGCCTCTGAATGTTCCTGAATCTT

CTTACCATGATCTACTCCCTCCATGTCCCTTCATAATCACTGCCACAGGGTAGGGACTTAGGCCAAGCACTGCCACCTCCTCTAGGGTGTGCGTCAAGTC

TTGGCTGACAACAGTGTTGATGTGGATGGAATTTCTCCATGTTTGGCCCTGCTTATCTCCTTTTACGTCACCCTCATCCCAGAACACAGCCTAGGGTCAT

CACCCTGAACTCAGGATTGCCCCATTCATTTGGAAGGGATCTTATGATTCCTGTCTTTGTCACTGATTGCTGTCCTAGCCCCCCCCCCCCCAGGGTGCCC

AATGAGACACAGTGAGCAGTGAAAAAAAAACCTGAGGTAGCTTCCTTCAAACCAACTTCCTCATAGATTCAGGACCTAGATCATTGCTTCTGTGCAGAAC

CTCATGGGATTTTTTTTTTTTCCCAAGACAGGGTTTCTCTGTATAGCCCTGGCTGTCCTGAAACTCACACTGTAGACCAGGCTGGCCTCGAACTCAGAGA

TATGGGGCCTCTTCCTACTGAGTGCTGGGATTAAAGATGTGCACCGCCACTATCCAGCATCTCATGGGTATTCAAGAATAAAGATCATTTTCCCT
Translation
MCFPGSQISPARLYYLVSAPWICTGSLTSSRLPRRRESGPLRVPPRSVQAERILRLPAFGLPLLALLLVPLLPVRAQNPDAKVVSMGV EWLTRYGYLPP

ADPVHAQMQSLEKLQDAIKVMQRFAGLPETGQMD - UNI17560 - DPMTIKTMRKPRCSLPDVLGAAGLVRRRRRYSLSGSVWKKRTLTWS SIRSF

SQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQDSYPFDGSGGTLAHAFFPGEHPISGDTHFDDEETWTFGSTD DDNGID

LFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYG GRVSQNPNARPTRKPLVPPPQPPAMPPDS SPATPVPDRCEGNFD

AVANIRGEIFLFKG GPWFWRLQPSGQLVSPRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSG GPQFWVFQERQLEGAARPLVEFGLPPGEDVDA

VFSWPHNGKTYLIRGQKYWRYDEVAARPDPGYPRALSLWDGAPFAPDDVTISNTG GDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDCPAPNSDPR

VTSPPKTTSKTRSCDCHCELNQASEQLSPLLLPLLPLVAGEVFSY

For any suggestions or comments, please send an email to unitrap@crg.es