Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023921 (Mut)
Chromosomal location
Chr 17: 41071656 - 41097848 (+)
Description
methylmalonyl-Coenzyme A mutase Gene [Source:MGI Symbol;Acc:MGI:97239]
RefSeq_dna
NM_008650 
RefSeq_peptide
NP_032676.2 
UniGene
Mm.259884 
MGI
MGI:97239 
Uniprot/SWISSPROT
P16332 
Uniprot/SPTREMBL
Q3UFU2 Q3UJU1 Q8BMR7 Q8VED0 Q9CSI4 
Human Ortholog
ENSG00000146085 (MUT)
Omim 251000 - METHYLMALONIC ACIDURIA DUE TO METHYLMALONYL-CoA MUTASE DEFICIENCY  
UniTrap UNI27243
Vector Insertion
Chr 17: 41071729 - 41073992
Public Clones (ggtc)
Private Clones OST65840 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097323
Sequence
GCGAGCGGGTGTGACCCCGGCGTCTGGGTTCGGTTCTGAAGTCCGGGCTTGGTCCGGGTGATCCCCAAACACT - UNI27243 - GACCGTTCTCATT

TCCTTTTGGGAGTATTCATGCTTCACCATGTTGAGAGCTAAGAATCAACTTTTTTTGCTATCGCCCCATTACCTGAAGCAGCTAAACATTCCATCAGCTT

CCAGATGGAAACGCCTTCTACACCAGCAGCAACCCCTTCACCCAGAATGGGCTGTACTGGCCAAAAAGCAGCTGAAAGGCAAAAACCCAGAGGACCTTAT

ATGGCACACCCCAGAAGGGATCTCTATAAAGCCCTTATATTCCAGGGCAGATACTCTGGACTTACCCGAAGAACTTCCAGGAGTGAAGCCATTCACACGG

GGACCATATCCTACCATGTATACCTATAGGCCCTGGACCATCCGTCAGTATGCAGGCTTTAGTACTGTGGAAGAAAGCAATAAATTCTATAAGGACAATA

TTAAGG CTGGTCAGCAGGGGTTGTCTGTTGCCTTTGACTTGGCAACACATCGTGGTTATGATTCAGACAACCCCAGAGTTCGTGGAGATGTTGGAATGG

CTGGAGTTGCTATTGACACTGTAGAAGACACCAAAATCCTATTTGATGGCATTCCTTTAGAAAAAATGTCCGTTTCCATGACTATGAACGGAGCTGTCAT

CCCAGTCCTGGCAACATTTATAGTAACTGGGGAAGAGCAAGGTGTGCCGAAGGAGAAGCTCACTGGCACAATTCAGAATGACATCCTAAAGGAGTTTATG

GTCAGAAATACTTATATTTTTCCCCCAGAGCCATCGATGAAAATTATTGCTGACATTTTCCAATACACAGCACAG CACATGCCAAAATTTAATTCCATT

TCGATTAGCGGGTACCATATGCAGGAAGCAGGAGCTGATGCCATTTTAGAACTGGCCTATACCATCGCAGATGGGTTGGAGTACTGCAGAACTGGACTCC

AGGCTGGACTCACAATTGATGAATTTGCACCAAG GTTGTCTTTCTTCTGGGGAATTGGAATGAACTTCTACATGGAAATAGCCAAGATGCGAGCTGGGA

GAAGACTGTGGGCTCACTTAATAGAAAAAATGTTCCAGCCTAAAAACTCTAAATCTCTTCTTCTAAGAGCACACTGCCAGACATCGGGGTGGTCACTTAC

TGAGCAG GATCCTTACAATAACATTGTCCGCACTGCAATCGAAGCCATGGCAGCTGTGTTTGGAGGAACCCAGTCTTTGCATACGAACTCTTTTGATGA

AGCGCTGGGTTTGCCCACTGTGAAAAGTGCCCGGATTGCTCGGAACACACAGATCATCATTCAGGAAGAATCTGGGATCCCCAAAGTGGCGGATCCTTGG

GGAGGGTCGTACATGATGGAGTCGCTCACAAATGACGTTTATGAGGCTGCTCTGAAG TTGATATATGAAGTTGAAGAAATGGGTGGAATGGCCAAAGCT

GTAGCTGAAGGAATCCCTAAACTTCGCATTGAAGAATGTGCTGCCCGAAGACAAGCTAGAATAGATTCTG GTTCTGAGGTAATTGTTGGAGTAAATAAG

TATCAGTTGGAAAAAGAAGACTCTGTGGAGGTCCTGGCCATTGACAACACTTCAGTGCGTAAGAAGCAGATTGAAAAACTCAAGAAG ATTAAATCCAGC

AGGGATCAAGCTTTGGCTGAGCAGTGTCTCAGTGCACTTACCCAGTGTGCTGCCAGTGGAGATGGCAATATTCTGGCTCTGGCAGTGGATGCAGCTCGTG

CAAG ATGTACAGTTGGAGAAATCACGGATGCCTTGAAAAAAGTATTTGGTGAGCATAAAGCTAATGATCGTATGGTGAGTGGAGCATATCGGCAGGAGT

TTGGAGAAAGTAAAGAGATCACATCTGCCATCAAGAG AGTTAATAAATTCATGGAACGTGAAGGTCGCAGACCTCGTCTTCTTGTGGCAAAAATGGGAC

AAGATGGCCATGACAGGGGAGCCAAGGTCATTGCTACAGGATTTGCTGATCTTGGTTTTGATGTGGACATAGGCCCTCTTTTTCAG ACTCCCCGTGAAG

TGGCGCAGCAAGCTGTGGATGCAGATGTCCATGCTGTGGGTGTCAGCACACTTGCTGCTGGTCATAAAACCCTCGTTCCTGAGCTTATCAAAGAACTCAC

CGCCCTGGGGCGGCCAGATATCCTTGTCATGTGTGGGGGCGTGATTCCACCACAG GATTATGAATTTCTGTATGAAGTTGGTGTTTCCAACGTCTTTGG

TCCTGGAACCCGGATTCCAAGAGCTGCTGTCCAAGTGCTTGATGATATTGAGAAGTGTTTGGCAGAGAAGCAGCAGTCTGTGTAACATCTGGATCTTTAG

TTATGACTGAAGCAGCAGTCTGTGTAACATCTGGATCTTTAGTTATGACCGAAGAAGGTAGTGGTAAATCCGTTTCGTCAGGTAATCCCAGCAGCTCTTA

GAATGCTTGCTTTGGAAACCTCACATTAAAAGATTCTAACTATAAATGTGCAGTCATGCCAATACACATATTTAAAGAATCTGAGTTC
Translation
 - UNI27243 - MLRAKNQLFLLSPHYLKQLNIPSASRWKRLLHQQQPLHPEWAVLAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGV

KPFTRGPYPTMYTYRPWTIRQYAGFSTVEESNKFYKDNIKA AGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSM

TMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFQYTAQ HMPKFNSISISGYHMQEAGADAILELAYTIADGL

EYCRTGLQAGLTIDEFAPR RLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQ DPYNNIVRTAIEAMAAVFGGT

QSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPKVADPWGGSYMMESLTNDVYEAALK LIYEVEEMGGMAKAVAEGIPKLRIEECAARRQARIDS

G GSEVIVGVNKYQLEKEDSVEVLAIDNTSVRKKQIEKLKK IKSSRDQALAEQCLSALTQCAASGDGNILALAVDAARAR RCTVGEITDALKKVFGEH

KANDRMVSGAYRQEFGESKEITSAIKR RVNKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQ TPREVAQQAVDADVHAVGVST

LAAGHKTLVPELIKELTALGRPDILVMCGGVIPPQ DYEFLYEVGVSNVFGPGTRIPRAAVQVLDDIEKCLAEKQQSV

For any suggestions or comments, please send an email to unitrap@crg.es