Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023931 (Efhb)
Chromosomal location
Chr 17: 53538214 - 53602646 (-)
Description
EF hand domain family, member B Gene [Source:MGI Symbol;Acc:MGI:3045296]
RefSeq_dna
NM_172497 
RefSeq_peptide
NP_766085.1 
MGI
MGI:3045296 
Uniprot/SWISSPROT
Q8CDU5 
Uniprot/SPTREMBL
A2RSG9 
Human Ortholog
ENSG00000163576 (EFHB)
Omim not available
UniTrap UNI36195
Vector Insertion
Chr 17: 53591885 - 53602647
Public Clones IST12901H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21318
Vector Insertion
Chr 17: 53591020 - 53591885
Public Clones not available
Private Clones OST334543 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22147
Vector Insertion
Chr 17: 53585181 - 53588709
Public Clones not available
Private Clones OST306674 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024725
Sequence
AGTGTCCTAGGCAGGAAGTAGTCTGCACGGAGTACTGGGAGTATGTGTTCGTTTGTGAGAGTGGGGTCCCCCAAACCTTTGCAAACTTCAGCTTCTCCGT

TAGAGATGAGTTCCCTGAGAAGGACGAGAGCACCTGAAATCTCGGAACTTGGACTCACCCCAGAGCAAAAGGACGATATAAGAGACAGGGTACTTAGGGG

GTCAAAATCTCCCACGGAGCTGGGGTTTGACTTGAGACTAGAACAAGATCGAAAATGGAGAGAGAGGATGGGATCATCAGAAGCAAAATCGCCACCTTGC

CATGCTCTTGGAGTAGGATTAGAAAGACATACTATTTCTGGGACACCCACAGAGATGGGTAATTTAGGACTTCACAAAGGCTCTGCCTTCCAGGGATCAA

AACCTCTGGGTGTGTTACCAGGAAGAGTGGGGCCAGAAAACAAGGGCCTTCCGCCTCGCCTTCGCTACGGAGGGACACTACACCCTCCTTTCAGCACAGT

ACATGCAAGTCCGCTGGCGGCAGAGAGCAGAAGGAGGCCTTTAGCCTGGGGTTCTGCTTGGACGGATGCTGTAGTGGAAAAGCAACCTGTTGTAGGTTTG

GAACTGAGAAAAGAACCGGAAAAAGAACCCACCTGTGTCGTGATGAACCCCTACCCAGAGATGCCCCCTAAGGAGGTAGACATCGGGTTGCCACAAACTC

AGGAATCAGATGAAGCCAAGAATACAGAGCCTCTAATAGGTTTAGTAAGAGAACCTTCTGAATGTCCATTTGCCCAACAACCGGAAGAGAAAAAGGAGCC

CGGCAGCACCGAACCCGGAGTGGAGCCTCCAGGGAACATCAGGCCCATATACTCAGGGAAGTTCTTTGATCGGGTGCCTTGCTGGCCAAGT - UNI361

95 - GCAGGAAAAGTTAAGCCAGTTGGATACAGAGTTGCAACCTGTTTGACTGAGAAGCTTCCCAGG - UNI21318 - - UNI36195 - CTAAT

GACTCCCCCAGAGGCAAAGAAGTATTTCAACTTCAGATATCCACCTGCTGGAGCAGAAAGAGTATTTTATGGCAGAGCAAATGACCCCCAAATTGCACCT

TATTTGACACATGGACTAAGATCTAAAATCTCAATACCG ATGGGATCATTGATAAACCCACAGCCCATTACCACGTTTCAACAGAAAATTAAAGACAAA

AAAGAATCTATATATTTTAGCCATCAACGAGCACCATTGGGAAAATCTCATGATCAAACACCAGGATTGCCAAAAGGAATGGATGTGATCAACACAACAT

TAGGGACACCGACTATCAGAG - UNI22147 - AACTGTCTGTTCGTGACACTGTGAATCCATCGAAATCCTTCGAAGATGTGCTTAAAGAAGGACAG

GAAGGACATGATTTGTACACTGTCTCTCACAATGATTATTTTGCAG GAGAAGCAAAGAATCGAAAATATAACCCGGCAAGCTTCCATAGGTTTAACTTG

TATGGAATCCCAACACCTCACTTTAATGATGGGCGCACCATGGCTAAAGCTTTACATTGGCTCCATGAACTACAAAT GGAAAGAGGAGCGAAAATTGTA

TCCAAAAGAGTTGATGACTTCAAAGAGAAATTTCAACACAAACTTGGAAAAGTTTTAGACCC CATTGCAGAAACTATGAATGTTCCCCCAGGTCACACA

TTTGGAAGTTGCCTCCATCCTGAGGAATATG GAGCTGGCGATCTCATCCATTATAGAAGCCCAGATGAATATCTTCGTGGGAAGGACCACCAGAGAGCC

GTGGTTGCAGCTGCTCGCCACCACTTGAAGAAATTTAATCACCAGAACTTTGACACTTTGCAGGTGGCTTTCAGGCACTATGACAAG AAGGGAGATGGG

GTGATTGACAGAGCAGAACTTCATGAAGCTTGTGTCCAAGCCAACCTGCATCTAGACAAGATGCTCCTGGACCATCTGTTTGACTACTGTGACGTGGACC

AGGATGGCTTGATCAACTACCTGGAATTTGCCAATTTCCTTAACTGGAAAGACAGAATACCTCTCAAAGAGCATGAGAAGAGGGTCGTTGTTAAAG GTA

AAAAACCAGACTGTGAAAACGTTACTGATACTAGCATGGGAGAAGCTGAACCAAGTCTCCTGATAAATCCTGAAGACATTGTCCCCAAAGAACCAGGAAG

TTCAGAAGAGACTCTCCGGACAATCCAGAGACCAGGTGACAAAGTTTCTCACCAGTATAAGACAACGTCTTCTGAGATCAACGCTGTGGTTGGAGCTGTC

CCCTCCATGT GTCACCCCATATTCGGTGTTCCAACCATTCGATCTGACATCTCTGCTCCCCGGATTCGTCGAGTCAGTGACATGAATAACTACGGTGAC

GAAGGCAATGCTTACTCTCTGCTGCACCCCTCCATCTTCTCCCAGAAAGGTGTATTTGAGAGAGACTTCTTCAAGACAAGGTCAAAGGAAGAG ATTTCA

GATATATTAACTAACATTGGAGTCAAGCTTTCTAAGGAAGAATTCGAAAATGTGTGGAATCTTGCTTCAAAAAAACACCAGCGAGGAGAAGTTTGTGTTG

AAACTATCAGGAACGTTCTAGATGAGCTACTGCATGCAGACCTCGTCAAGTGTAAAACGGCCATGTGATTGATATTTTTGGGAACTTACACATTTAAGCA

AAGCAGATTAAATCTATATTCATCT
Translation
MCSFVRVGSPKPLQTSASPLEMSSLRRTRAPEISELGLTPEQKDDIRDRVLRGSKSPTELGFDLRLEQDRKWRERMGSSEAKSPPCHALGVGLERHTISG

TPTEMGNLGLHKGSAFQGSKPLGVLPGRVGPENKGLPPRLRYGGTLHPPFSTVHASPLAAESRRRPLAWGSAWTDAVVEKQPVVGLELRKEPEKEPTCVV

MNPYPEMPPKEVDIGLPQTQESDEAKNTEPLIGLVREPSECPFAQQPEEKKEPGSTEPGVEPPGNIRPIYSGKFFDRVPCWPS - UNI36195 - AGK

VKPVGYRVATCLTEKLPR - UNI21318 - - UNI36195 - LMTPPEAKKYFNFRYPPAGAERVFYGRANDPQIAPYLTHGLRSKISIP MGSLIN

PQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRE - UNI22147 - ELSVRDTVNPSKSFEDVLKEGQEGHDLYTVS

HNDYFAG GEAKNRKYNPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQM MERGAKIVSKRVDDFKEKFQHKLGKVLDP PIAETMNVPPGHTFGSC

LHPEEYG GAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDK KGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQD

GLINYLEFANFLNWKDRIPLKEHEKRVVVKG GKKPDCENVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAV

PSMC CHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEE ISDILTNIGVKLSKEEFENVWNLASKKHQRGEV

CVETIRNVLDELLHADLVKCKTAM

For any suggestions or comments, please send an email to unitrap@crg.es