Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023944 (Hsp90ab1)
Chromosomal location
Chr 17: 45704728 - 45710220 (-)
Description
heat shock protein 90kDa alpha (cytosolic), class B member 1 Gene [Source:MGI (curated);Acc:Hsp90ab1-001]
RefSeq_dna
NM_008302 
RefSeq_peptide
NP_032328.2 
UniGene
Mm.2180 Mm.246589 Mm.379323 Mm.381250 Mm.413436 
MGI
MGI:96247 
Uniprot/SWISSPROT
P11499 
Uniprot/SPTREMBL
Q71LX8 Q80YC2 Q811H6 
Human Ortholog
ENSG00000205527 (HSP90AB4P)
Omim not available
UniTrap UNI12431
Vector Insertion
Chr 17: 45708861 - 45710115
Public Clones (sanger) 5SE311C10 (ggtc) W099D03 (ggtc) CMHD-GT_423G5-3 (cmhd) CMHD-GT_487H1-3 (cmhd)
IST14800G8 (tigm) IST14710D9 (tigm)
Private Clones OST338471 (lexicon) OST317346 (lexicon) OST289819 (lexicon) OST279219 (lexicon)
OST260687 (lexicon) OST249762 (lexicon) OST204612 (lexicon) OST189632 (lexicon)
OST182528 (lexicon) OST5974 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12569
Vector Insertion
Chr 17: 45708569 - 45708713
Public Clones M052C04 (ggtc)
Private Clones OST16883 (lexicon) OST8722 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23219
Vector Insertion
Chr 17: 45708127 - 45708361
Public Clones not available
Private Clones OST270326 (lexicon) OST169618 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7536
Vector Insertion
Chr 17: 45706337 - 45706418
Public Clones RRR480 (baygenomics) RRR677 (baygenomics) RRR163 (baygenomics) RRR706 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14564
Vector Insertion
Chr 17: 45704727 - 45705512
Public Clones CMHD-GT_396B9-3 (cmhd) FHCRC-GT-S6-11C1 (fhcrc)
Private Clones OST181473 (lexicon) OST171790 (lexicon) OST107360 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024739
Sequence
GAGCTCTCTTGAGTCACCCCCGCGCAGCCTAGGCTTGCCGTGCGAGTCGGACTTGGTCCGGGCCCACCACCCTGCTCTGTACTACTACTCGGCTTTCCCG

TCAAG - UNI12431 - ATGCCTGAGGAAGTGCACCATGGAGAGGAGGAGGTGGAGACCTTTGCCTTTCAGGCAGAAATTGCCCAGCTCATGTCCCTC

ATCATCAACACTTTCTATTCAAACAAGGAGATTTTCCTCCGCGAGTTGATCTCTAATGCTTCAGAT - UNI12569 - GCCCTGGACAAGATTCGATA

TGAGAGCCTGACGGACCCTTCTAAGTTGGACAGTGGGAAAGAGCTGAAAATTGACATCATCCCCAACCCTCAGGAGCGCACGCTGACTTTGGTGGACACA

GGCATTGGCATGACCAAGGCTGACCTCATTAATAACCTGGGAACCATTGCTAAGTCTGGCACGAAGGCGTTCATGGAGGCTCTCCAG - UNI23219 -

 GCTGGTGCAGACATCTCCATGATCGGGCAGTTTGGTGTCGGATTCTACTCGGCCTATCTAGTTGCAGAGAAAGTGGTTGTGATCACGAAGCACAATGAT

GATGAGCAGTATGCCTGGGAGTCGTCTGCGGGTGGCTCCTTCACCGTCCGGGCAGACCATG GTGAGCCCATTGGCCGGGGTACCAAAGTGATCCTTCAC

CTCAAAGAAGACCAGACAGAGTACTTGGAGGAGAGGAGGGTCAAGGAAGTGGTGAAGAAACATTCGCAGTTCATAGGCTATCCCATCACCCTCTAT TTG

GAGAAGGAACGGGAGAAGGAGATCAGTGATGATGAGGCAGAGGAAGAGAAAGGTGAGAAAGAGGAGGAAGATAAGGAGGATGAGGAGAAGCCTAAGATTG

AAGATGTGGGATCCGATGAGGAAGATGACAGCGGCAAAGACAAGAAAAAGAAAACAAAGAAGATCAAAGAGAAGTACATTGACCAGGAGGAGCTGAACAA

GACAAAGCCTATCTGGACCAGAAACCCGGATGACATCACGCAGGAGGAGTATGGCGAATTCTATAAGAGCCTCACCAATGACTGGGAGGACCACTTGGCA

GTCAAG CACTTCTCTGTAGAAGGTCAGTTGGAATTCAGGGCATTGCTCTTCATTCCCCGGCGGGCTCCCTTCGACCTTTTTGAGAACAAGAAGAAGAAG

AACAACATCAAATTGTATGTCCGCCGTGTGTTCATCATGGACAGCTGTGACGAGCTGATACCTGAGTACCTCAACTTTATCCGCGGTGTGGTTGACTCCG

AGGACCTGCCCCTGAACATCTCCCGGGAGATGCTGCAGCAGAGCAAGATCCTGAAGGTCATCCGCAAGAACATCGTCAAGAAGTGCCTGGAGCTCTTCTC

CGAGCTGGCTGAGGACAAGGAGAACTACAAGAAGTTCTATGAGGCCTTCTCCAAAAATTTAAAG - UNI7536 - CTTGGAATTCATGAAGATTCCAC

TAACCGACGCCGCCTCTCTGAGCTCCTTCGCTATCACACCTCTCAGTCTGGAGATGAGATGACCTCCTTGTCAGAGTATGTGTCTCGCATGAAGGAGACC

CAGAAGTCCATCTACTATATCACTG GTGAGAGCAAAGAGCAAGTGGCCAACTCTGCCTTTGTGGAGCGAGTGCGGAAGCGGGGCTTCGAGGTGGTGTAT

ATGACTGAGCCTATTGACGAGTACTGCGTGCAGCAGCTCAAGGAGTTTGATGGGAAGAGCCTGGTCTCAGTGACTAAGGAGGGCCTGGAGCTACCAGAGG

ACGAGGAAGAGAAGAAGAAAATGGAGGAGAGCAAGGCAAAGTTTGAGAATCTCTGCAAGCTCATGAAGGAGATCTTGGACAAGAAGGTTGAAAAG - UN

I14564 - GTGACAATCTCCAATAGGCTTGTGTCTTCACCCTGCTGCATTGTGACAAGCACCTATGGCTGGACAGCCAACATGGAACGGATCATGAAGG

CCCAGGCACTGCGAGACAACTCTACAATGGGCTACATGATGGCCAAAAAACACCTGGAGATCAACCCTGACCACCCCATCGTGGAGACCCTGCGGCAGAA

GGCTGAGGCAGACAAAAACGACAAAGCTGTCAAGGACCTGGTGGTGCTGCTGTTTGAAACTGCTCTGCTCTCCTCTGGTTTCTCACTTGAGGATCCCCAA

ACCCACTCCAACCGCATCTACCGCATGATTAAACTAGGCCTGG - UNI14564 - GCATCGATGAAGATGAGGTCACTGCAGAGGAGCCCAGTGCTGC

TGTTCCTGATGAGATCCCCCCTCTGGAAGGCGATGAGGATGCCTCGCGCATGGAAGAGGTGGATTAAAGCCTCCTGGAAGAAGCCCTGCCCTCTGTATAG

TATCCCCGTGGCTCCCCCAGCAGCCCTGACCCACCTGGCTCTCTGCTCATGTCTACAAGAATCTTCTATCCTGTCCTGTGCCTTAAGGCAGGAAGATCCC

CTCCCACAGAATAGCAGGGTTGGGTGTTATGTATTGTGGTTTTTTTGTTTGTTTTATTTTGTTCTAAAATTAAAAGTATGCAAAATAAAGAAGATGCAGT

TTT
Translation
 - UNI12431 - MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASD - UNI12569 - ALDKIRYESLTDPSKLDSGKELK

IDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ - UNI23219 - AGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWE

SSAGGSFTVRADHG GEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLY LEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGS

DEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVK HFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIK

LYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLK - UNI7536 - LGI

HEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITG GESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKE

GLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEK - UNI14564 - VTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKH

LEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLG - UNI14564 - GIDEDEVTAEEPSAAVPDEIPP

LEGDEDASRMEEVD

For any suggestions or comments, please send an email to unitrap@crg.es