Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023953 (Polh)
Chromosomal location
Chr 17: 46308305 - 46339544 (-)
Description
polymerase (DNA directed), eta (RAD 30 related) Gene [Source:MGI Symbol;Acc:MGI:1891457]
RefSeq_dna
NM_030715 
RefSeq_peptide
NP_109640.1 
UniGene
Mm.311585 
MGI
MGI:1891457 
Uniprot/SWISSPROT
Q9JJN0 
Uniprot/SPTREMBL
A1A556 
Human Ortholog
ENSG00000170734 (POLH)
Omim 278750 - XERODERMA PIGMENTOSUM, VARIANT TYPE  
UniTrap UNI27257
Vector Insertion
Chr 17: 46336484 - 46339345
Public Clones not available
Private Clones OST65508 (lexicon) OST55750 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34522
Vector Insertion
Chr 17: 46319633 - 46321759
Public Clones IST12891D8 (tigm) IST12337D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32555
Vector Insertion
Chr 17: 46308304 - 46312270
Public Clones IST13167C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024749
Sequence
GGGCTTGCTGTGGGGCGTAAACCTGCAGGCTGGAAGGGCTGTTGGCTCGGCGGGAGCCTAGGGCTACCTACTCGGATCTGTGTTATCAGATTACACTCAC

TTGCTCCTGGGAAGGCGACGACGACATCTAGACGCTGTCATTGGACTCCGCCCGGAGCCCGCAGCTTCGCTCTTGGCAGTTTTGACAGGTGTCGCCTTG 

- UNI27257 - AAATAAATGGCTCCTGGGCAGAATCGAGTGGTTGCTCTTGTAGACATGGACTGCTTTTTTGTACAAGTGGAACAGCGGCAAAATCCT

CATTTGAGGAATAAACCTTGTGCAGTTGTACAGTACAAATCATGGAAAGGTGGTGG AATTATTGCAGTTAGCTATGAAGCCCGAGCATTTGGTGTCACT

AGAAACATGTGGGCGGATGATGCTAAGAAGTTATGTCCAGATCTTCTCCTGGCACAAGTTCGTGAGTCCCGTGGAAAAGCTAACCTCACCAA GTACCGG

GAAGCTAGTGTTGAAGTGATGGAGATAATGTCTTATTTTGCTGTGATTGAACGTGCCAGCATCGATGAGGCTTATATAGATTTGACCAGTGCTGTACAAG

AAAGACTTCAAAAGTTACAAGGTCAGCCTATCTCAGCAGATTTGCTGCCAAGCACTTACATTGAAGGGTTGCCCCGAGGCCCTACAGTAGAAGAGACTGT

TCAGAAAG AGGCTATTCGGAAACAAGGCTTGCTTCAGTGGCTTGATTCTCTTCAGAGTGATGATCCCACCTCTCCAGACCTCAGGCTGACTGTGGGAGC

CATGATTGTGGAAGAAATGAGAGCAGCCATAGAGAGTAAGACTGGCTTCCAGTGTTCAGCTGGAATCTCACACAATAAG GTCCTGGCAAAACTTGCTTG

TGGACTAAATAAGCCCAACCGCCAAACCCTGGTCTCACATGGGTCAGTGCCACAGCTCTTCAGCCAGATGCCAATCCGTAAAAT - UNI34522 - CC

GAAGTCTTGGAGGAAAGCTAGGGGCTTCTGTCATTGAAGTCCTTGGGATAGAATACATGGGTGACCTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCA

TTTTGGAGAGAAGAATGG - UNI34522 - GTCTTGGCTGTATGCCATGTGTCGAGGTATTGAACACGATCCAGTTAAACCCAGGCAGTTACCTAAAA

CTATTGGCTGCAGCAAGAACTTCCCAGGGAAAACAGCTCTGGCTACTCGGGAGCAG - UNI34522 - GTACAGTGGTGGCTTTTGCAGTTAGCTCTG

GAACTTGAGGAGAGGCTAACCAAAGATCGAAATGAT - UNI32555 - AATGACCGCGTGGCCACTCAGCTGGTCGTCAGTATTCGTTTTCAGGGAGA

CAGGCGTCTCAGCAGCCTGCGGCGGTGCTGTGCCCTCCCTCGCTATGACGCTCACAAGATGAGCCAGGACGCATTTGCTGCCATCAGGAACTGTAATACA

TCTGGAATCCAAACTGAGTG - UNI32555 - GTCCCCTCCTCTCACAATGCTCTTCCTCTGCGCTACCAAGTTCTCTGCGGCTGCCCCTCCAGCTTG

CACGGATATCACTGCGTTCCTGAGTAGCGACTCAAGTTGTCAGCCAAAGGTGCCAATTGCCAGCTCTGAGACTAGGACCCAGGGGTCTGGCCCAGCTGTA

CCAACCTCTAAAGAGGCAGCCACATCTCTAGCGTCTTTTTTTCAAAAAGCTGCCAAAAAGCAGAGAATGAAAGAGACTTCCTTTGTACCTCTTAACACAG

CCACAGAGAAGTTATCATCCAAGCCTTCACTTGTGTTCCAAAGCAGCCAAACCACAGGAAGTCAGTCTTTCTTTAAGCAGAAGAGCCTGCTGCTCCAGCA

CACACAGCTTAGTAACTCTGCGGCTCCTGACCCTCCACAGGCCAGCCCTGCAGCGCAACCAAGCTGTCTGCCAGCAGAGTGTGTAGACAGTGGTCCTGAT

GATGGAGCGGTGAAGCCAGTATCCTCTAAAGCAGTGTCTACAGAAATGAATGTGGCTGGGGACAGTCCAAACGTGCTCGATTCTCCAGCTTACAACTCTC

AGGAGGTGACCCAAAGGGCCACTGAGGACCAAGTGCTCTGTGAGAAGTGTGACTCCCTGGTTCCAGTGTGGGACATGCCAGAACACACGGACTACCATTT

TGCATTGGAGTTGCAGAAGTCTTTTTTGCAGCCTTGTACTTCAAAACCCCAGGCTATTCCTGCCGTGTCTCCTCAGGGCAAAAGAAATCCCAAGAGTCCC

TCGGCTTCCAGTAGTAAGCGCCTTAGGCCCCATGGCATGCAGACGCTGGAATCGTTTTTTAAGCCACTGACACATTAGTGCTGCCTGGGGCATCAGGAGG

GCTCTACTATTTTTTTTCTAACGGATGGAATCATGTTGACTGCTCAAGGGGAATATGACATTTCTAATACAAAGTTAGGGGTTTTTTCTTCCAATGGGAC

TCTGATCCTGTTGCTGATCAATGCTTTTCCTCTCTAGGGAGACAGAGTGTCATAAAAGGTATAAAGAACCTGGCAAGCTCACTTGCTTCCCTATAAACTA

ACTAAAGACTAAACAGGAGTATAACTCAAAAAAACTGTAAAAGAAAGGGGAAATGGGGCTGGAGATAGAGCTCACTTGTCTAGGACGGCATGTGCAAGGC

CCCATGTTCACTTCCCAGTTCTGGAAGGAAAACGAGGACTATTAAGATGGGCAAGTGCAAACGGCCAAAGTAATGGATTTAGCAGTCTTTTTCAGCCATG

CAGGCTTTTCTGATAAATTACATGACTTTGAATTATGTATGAAACCAGGTAGTAGGTTTAATGGATAGGAAAACAGCATAGATATTTTTTCCTACATAAA

TACAAATCAACTTTTTTTTTTTTTTTTTTTTTTTTTTGGTTTTTCGAGACAGAGTTTCTCTGTGTAGCTCTGGCTGTCCTGGAACTCACTTTGTAGACCA

GGCTGGCCTCGAACTCAGAAATCCGCCTGCCTCTGCTGGGATTAAAGGCTCATCAACTTACTTATAAATTGGGTCTTTGAAAGATTTGAAATTCACCGCG

TTTAGCCGGAAATTACCCTTTCCTTTGACTTTAGTGTGTAGCTTCTTCCCTGGCTAGATATGTAGTTTCTTAAAAGCAAGAACTCTTGCAGTGACTTACA

TGGAATATGTTCTTGATGTTGGTTGAATGTATGTATTAAATTAGCCACATTGAGACAATAAAAATGTACTCTTTG
Translation
 - UNI27257 - MAPGQNRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG GIIAVSYEARAFGVTRNMWADDAKKLCPDLLLAQVRESR

GKANLTK KYREASVEVMEIMSYFAVIERASIDEAYIDLTSAVQERLQKLQGQPISADLLPSTYIEGLPRGPTVEETVQKE EAIRKQGLLQWLDSLQSD

DPTSPDLRLTVGAMIVEEMRAAIESKTGFQCSAGISHNK VLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKI - UNI34522 - IRSLGGKLGAS

VIEVLGIEYMGDLTQFTESQLQSHFGEKNG - UNI34522 - GSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQ - UNI34522 - 

VQWWLLQLALELEERLTKDRND - UNI32555 - NDRVATQLVVSIRFQGDRRLSSLRRCCALPRYDAHKMSQDAFAAIRNCNTSGIQTEW - UNI3

2555 - WSPPLTMLFLCATKFSAAAPPACTDITAFLSSDSSCQPKVPIASSETRTQGSGPAVPTSKEAATSLASFFQKAAKKQRMKETSFVPLNTATEK

LSSKPSLVFQSSQTTGSQSFFKQKSLLLQHTQLSNSAAPDPPQASPAAQPSCLPAECVDSGPDDGAVKPVSSKAVSTEMNVAGDSPNVLDSPAYNSQEVT

QRATEDQVLCEKCDSLVPVWDMPEHTDYHFALELQKSFLQPCTSKPQAIPAVSPQGKRNPKSPSASSSKRLRPHGMQTLESFFKPLTH

For any suggestions or comments, please send an email to unitrap@crg.es