Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023965 (Fbxl17)
Chromosomal location
Chr 17: 63407131 - 63848649 (-)
Description
F-box and leucine-rich repeat protein 17 Gene [Source:MGI Symbol;Acc:MGI:1354704]
UniGene
Mm.401176 
MGI
MGI:1354704 
Uniprot/SWISSPROT
Q9QZN1 
Uniprot/SPTREMBL
B2RRC1 Q3U407 
Human Ortholog
ENSG00000145743 (FBXL17)
Omim not available
UniTrap UNI7930
Vector Insertion
Chr 17: 63842103 - 63848373
Public Clones RRM165 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27291
Vector Insertion
Chr 17: 63840237 - 63842037
Public Clones not available
Private Clones OST64847 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36507
Vector Insertion
Chr 17: 63734293 - 63801015
Public Clones IST12990G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1431
Vector Insertion
Chr 17: 63706228 - 63734293
Public Clones CG0713 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38542
Vector Insertion
Chr 17: 63429769 - 63574451
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112839
Sequence
ATGGACCCTTTTGGTTTTGTGCTGCTGGATAAAGAAGGAATGAAGTATGAAAAGACACAAACAAAGAAGCCAGGGAAGGCGAAG - UNI36507 - GT

GACAGATCAGTCAGTGAAGGCATTTGCTGAGCACTGTCCTGAACTCCAGTATGTTGGCTTCATGGGTTGTTCAGTTACTTCCAAAGGAGTCATTCACTTA

ACCAAG - UNI1431 - - UNI36507 - CTAAGGAACCTGTCCAGCTTAGACCTCCGTCACATCACTGAACTGGATAATGAAACCGTGATGGAAAT

CGTCAAGAGGTGCAAAAATCTCAGCTCTCTGAATCTCTGTCTGAACTGGATCATAAACGACAG GTGTGTGGAGGTCATTGCAAAGGAAGGACAGAACCT

GAAAGAGCTGTACCTGGTGTCCTGTAAGATCACTGATTATG CACTGATAGCCATTGGGCGATACAGCGTGACCATAGAGACTGTGGACGTCGGATGGTG

TAAAGAAATCACAGATCAAGGAGCCACCCTGATTGCACAGAGCAGCAAGTCCCTGAGATACTTGGGCCTGATGAGATGTGACAAA GTCAATGAATTGAC

AGTGGAGCAGCTGGTGCAGCAGTACCCGCACATCACCTTCAGCACCGTTCTGCAGGACTGCAAGAGGACCTTGGAGAGAGCCTACCAGATGGGCTGGACC

CCCAATATGTCCGCTGCCACCTCCTAACTCTCTTCCTATGCCCAGGTCTACTCAGGCCGGTTCAGCAGAATGGAGAAATGGGGGGCTCCAATAGGGGGTC

TTTCGGAAAGGTTTTAACCGTCACCTGTCAGTGTGTGTACCCGAGTGTTCCGTTTGTGTCTTGTTTGCATTCTGCATAGCATAAGCGCACTGTTACTTAC

CCCAAGGTGAGCTGGCTTGTTTTCCCTAAAACAGAAGATTATGAAAACCAGGACCTTTTTGTTTTTTGTTTTGTTTTCCAATTCAAACGTCTATTTCTCT

AAAAAGACTTTGTGGAATCTCAAGTCAGAAAACTGGTTGTATAGTTTTGAGCTTTTAAGTTCTGACACATCTCGGAAATGCTCGCAGAAAGGCTTTGTTC

GGTGATAGGTAGGCTACTTGTACGCTTCTGAGAAGACCAAAACAGAAGTGATGTTGCTCTAACTAGAAGCCTGGAGACTAGAACCCCTCAAAATCCTGGA

GTACACAGCTAAAGTTCCACTCTCTTGTACTGTCATACACACATGCTAGGTCAGGTTCTCGCTTGGTAAATTCTTTCCTGCCAGAGGAACCTTCCTGGGT

CATGAAGAGAGCATGCCTTCCACTGTGGCTATGCCTAACGTACTGTGCCCAGTGGTGGACAACTTGCTGTCTTATAGGTAACTTAGGAAGTAGACTGAAT

AAAGCCTTTTGTAAATTTGTATATGGAGGCAACAGTCTGATGTCCCCTGGCCAGCTCACAAAAGTTAATTATTCATTATTCTGTAAATGCATTCTGTTAA

GTAATAAATATTTTAGTTGGTTTTGCATTAACACTGTGTTCGCTTTTACTGTGTGGACAGTTACTGGTCAAGATGCATTTTAGTGACATTTGGGGCTAAT

CTTGGCATTATTCACATTGAAGCCATGAATGTAATTAATGGTGTGCAGTTATTTTAAAAATTTTACAGATCATTTCATTATTTTGGTAATTATGAAAATA

TATTCTGAGGTGGGGTAGTTATTGATAGAAGATTAATGAATGAGATGTATGTAGACAATCTTCCTATTGTATTTTTTTCCTTTGCTTTGGGATTGAGAAC

AGGTTTTTTGAATATATGCATGTTATAATTTTAAATAGTTCTTACACTACTGCAAAGATCTACTGTTAGCTAACGTATGAGCTAAGGAGAGAATTTAGAA

AATCTGTTCATTAAGATTCTGTTTACACTTGCCAGAAATACATATTTTAGTTTAATTAAGTATTACCAGCTTTTACTTCTGTCAGTACCTATCAGGAAAG

GAGTGTAAGTTTTGATGTCACACATTTCTACAGTCAGCCGTTGCAGGGACTCAGGCTCAGATGACCTCTCCTATGTCTGGATTTATAAGCAGGCAGCAGG

GAGCCTTTTTAAGCTAAAGAGTGATTATCTTTCGTAGTAGGAAAAGCAAAACCTTGACTTTTGAACTTGCTATTTATTCTCCCTGTATGTGGTCTTTGGT

CTTTAACAATTATAATGAGGTTTGAGTTTGTTTCCTATAAATCCCAGCCCTGCGGAAGCAATGCTAGCTGTAGGAGGCAGAAGCTGCCTTCCATTTGCAC

ACCATGCACGTGTGTGTAACAACTCCTTCTCTGTAGAAAAGGTTTGTTTCCCTCCAGTTTGTCAACATGCTTCTGATGTGGCAGTTTATTGTTTTAATCC

CAATCAGTTAAAAAACAAAAAGTACCTTTTTCATAACCAAATAGGAGATTTTATGTGACATATGTATTATTACATCATTACCATAGGAACCAAAGTCTAG

TCCCATGGATGTTATTTCCTCTTCCATTTTAATTGAGTCATGAACATGTACCAAAACCAGCTGGCAATATGACAGTCATTGCGACTGAAGGGTCAGTTGG

AGTCAGGCCTACTATGACTATCGGTAAATAGGAGGTTTTTCCTCTTGGGCACTATGCTTAGAAGATTAACTCAGCTCTCCTGCGGGATGTTTAATACACG

CATTGCCGCTACATGGGACTCTTCAGTCACCAAAACGCAGCCATCTGCAGGAACATATTCCCAAACTAAAACCATATCTAAGATCCTTCAGCGCCCAGTC

CTGTGATCTCCCTTGGCTAATAACGAACTGTAAGGATGCCAGCAGCTCATGAAGAAAGGGAGACTTCCAAAAGAGCCTGCGTTGTTTGATTCAGCTGTTT

TATTCACAACAGGATGGAAGAGACAGTCATGCATTTCTGAAAGTTTTTCCACAGTTTGGCATCACTTGAAAGATCTGGAGATGAGAAGCATTGATGGAAA

GTGGCCCGAGGACACAGGGCAGGCTGATGCTCGCTCACTAACTCTTCTGTAGCCTGAGATCTCCTCAGCCTGTGCCTTGTGCATGCATGCGCGCCCACAT

GCCCAAATGCACCATTCAGCCAGAAAAGATGACTACAGAACGCAGTCTGTTCAACTTTGTGATTAATATAATAGAAGATGGAAAAACGAGTCACTAAATA

AAGACTTGTTAAACCT
Translation
MDPFGFVLLDKEGMKYEKTQTKKPGKAK - UNI36507 - VTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTK - UNI1431 - - UNI3650

7 - LRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDR RCVEVIAKEGQNLKELYLVSCKITDYA ALIAIGRYSVTIETVDVGWCKEI

TDQGATLIAQSSKSLRYLGLMRCDK VNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS
Transcript ENSMUST00000112840
Sequence
GATTTCCCCCAGGCTCAAGGTTTAAAGCAGTAGCTTGGAGACCTACAGCCCTTGGTCATATAGAG - UNI27291 - ATATTTTCCAATTTGTCCCTG

AACGAACGCTGCCTTTCTGCATCGTTGGTTTGCAAGTACTGGCGTGACCTTTGCTTAGATTTCCAGTTTTGGAAGCAGCTGGACCTTAGTAGTCGTCAGC

AG GTTACTGATGAATTATTGGAAAAAATTGCCTCCAGAAGTCAGAATATAATTGAGATTAACATTTCTGATTGTCGAAGTCTGTCTGACAGTGGCGTGT

GTGTCCTAGCATTTAAGTGTCCTGGACTTCTTAGGTATACAGCCTACAGGTGTAAGCAGCTTTCTGACACCTCAATCATTGCGGTCGCGTCTCACTGCCC

TTTACTGCAGAAAGTCCACGTAGGCAACCAGGACAAGCTCACCGATGAAGGACTTAAGCAG CTGGGCTCAAGATGCAGAGAACTCAAAGACATCCATTT

TGGCCAGTGTTACAAGATCTCAGATGAAGGCATGATTGTCATAGCTAAGAGCTGCCTGAAGTTACAGAGGATATACATGCAGGAAAACAAATTA - UNI

36507 - GTGACAGATCAGTCAGTGAAGGCATTTGCTGAGCACTGTCCTGAACTCCAGTATGTTGGCTTCATGGGTTGTTCAGTTACTTCCAAAGGAGT

CATTCACTTAACCAAG - UNI1431 - - UNI36507 - CTAAGGAACCTGTCCAGCTTAGACCTCCGTCACATCACTGAACTGGATAATGAAACCG

TGATGGAAATCGTCAAGAGGTGCAAAAATCTCAGCTCTCTGAATCTCTGTCTGAACTGGATCATAAACGACAG GTGTGTGGAGGTCATTGCAAAGGAAG

GACAGAACCTGAAAGAGCTGTACCTGGTGTCCTGTAAGATCACTGATTATG CACTGATAGCCATTGGGCGATACAGCGTGACCATAGAGACTGTGGACG

TCGGATGGTGTAAAGAAATCACAGATCAAGGAGCCACCCTGATTGCACAGAGCAGCAAGTCCCTGAGATACTTGGGCCTGATGAGATGTGACAAA GTCA

ATGAATTGACAGTGGAGCAGCTGGTGCAGCAGTACCCGCACATCACCTTCAGCACCGTTCTGCAGGACTGCAAGAGGACCTTGGAGAGAGCCTACCAGAT

GGGCTGGACCCCCAATATGTCCGCTGCCACCTCCTAACTCTCTTCCTATGCCCAGGTCTACTCAGGCCGGTTCAGCAGAATGGAGAAATGGGGGGCTCCA

ATAGGGGGTCTTTCGGAAAGGTTTTAACCGTCACCTGTCAGTGTGTGTACCCGAGTGTTCCGTTTGTGTCTTGTTTGCATTCTGCATAGCATAAGCGCAC

TGTTACTTACCCCAAGGTGAGCTGGCTTGTTTTCCCTAAAACAGAAGATTATGAAAACCAGGACCTTTTTGTTTTTTGTTTTGTTTTCCAATTCAAACGT

CTATTTCTCTAAAAAGACTTTGTGGAATCTCAAGTCAGAAAACTGGTTGTATAGTTTTGAGCTTTTAAGTTCTGACACATCTCGGAAATGCTCGCAGAAA

GGCTTTGTTCGGTGATAGGTAGGCTACTTGTACGCTTCTGAGAAGACCAAAACAGAAGTGATGTTGCTCTAACTAGAAGCCTGGAGACTAGAACCCCTCA

AAATCCTGGAGTACACAGCTAAAGTTCCACTCTCTTGTACTGTCATACACACATGCTAGGTCAGGTTCTCGCTTGGTAAATTCTTTCCTGCCAGAGGAAC

CTTCCTGGGTCATGAAGAGAGCATGCCTTCCACTGTGGCTATGCCTAACGTACTGTGCCCAGTGGTGGACAACTTGCTGTCTTATAGGTAACTTAGGAAG

TAGACTGAATAAAGCCTTTTGTAAATTTGTATATGGAGGCAACAGTCTGATGTCCCCTGGCCAGCTCACAAAAGTTAATTATTCATTATTCTGTAAATGC

ATTCTGTTAAGTAATAAATATTTTAGTTGGTTTTGCATTAACACTGTGTTCGCTTTTACTGTGTGGACAGTTACTGGTCAAGATGCATTTTAGTGACATT

TGGGGCTAATCTTGGCATTATTCACATTGAAGCCATGAATGTAATTAATGGTGTGCAGTTATTTTAAAAATTTTACAGATCATTTCATTATTTTGGTAAT

TATGAAAATATATTCTGAGGTGGGGTAGTTATTGATAGAAGATTAATGAATGAGATGTATGTAGACAATCTTCCTATTGTATTTTTTTCCTTTGCTTTGG

GATTGAGAACAGGTTTTTTGAATATATGCATGTTATAATTTTAAATAGTTCTTACACTACTGCAAAGATCTACTGTTAGCTAACGTATGAGCTAAGGAGA

GAATTTAGAAAATCTGTTCATTAAGATTCTGTTTACACTTGCCAGAAATACATATTTTAGTTTAATTAAGTATTACCAGCTTTTACTTCTGTCAGTACCT

ATCAGGAAAGGAGTGTAAGTTTTGATGTCACACATTTCTACAGTCAGCCGTTGCAGGGACTCAGGCTCAGATGACCTCTCCTATGTCTGGATTTATAAGC

AGGCAGCAGGGAGCCTTTTTAAGCTAAAGAGTGATTATCTTTCGTAGTAGGAAAAGCAAAACCTTGACTTTTGAACTTGCTATTTATTCTCCCTGTATGT

GGTCTTTGGTCTTTAACAATTATAATGAGGTTTGAGTTTGTTTCCTATAAATCCCAGCCCTGCGGAAGCAATGCTAGCTGTAGGAGGCAGAAGCTGCCTT

CCATTTGCACACCATGCACGTGTGTGTAACAACTCCTTCTCTGTAGAAAAGGTTTGTTTCCCTCCAGTTTGTCAACATGCTTCTGATGTGGCAGTTTATT

GTTTTAATCCCAATCAGTTAAAAAACAAAAAGTACCTTTTTCATAACCAAATAGGAGATTTTATGTGACATATGTATTATTACATCATTACCATAGGAAC

CAAAGTCTAGTCCCATGGATGTTATTTCCTCTTCCATTTTAATTGAGTCATGAACATGTACCAAAACCAGCTGGCAATATGACAGTCATTGCGACTGAAG

GGTCAGTTGGAGTCAGGCCTACTATGACTATCGGTAAATAGGAGGTTTTTCCTCTTGGGCACTATGCTTAGAAGATTAACTCAGCTCTCCTGCGGGATGT

TTAATACACGCATTGCCGCTACATGGGACTCTTCAGTCACCAAAACGCAGCCATCTGCAGGAACATATTCCCAAACTAAAACCATATCTAAGATCCTTCA

GCGCCCAGTCCTGTGATCTCCCTTGGCTAATAACGAACTGTAAGGATGCCAGCAGCTCATGAAGAAAGGGAGACTTCCAAAAGAGCCTGCGTTGTTTGAT

TCAGCTGTTTTATTCACAACAGGATGGAAGAGACAGTCATGCATTTCTGAAAGTTTTTCCACAGTTTGGCATCACTTGAAAGATCTGGAGATGAGAAGCA

TTGATGGAAAGTGGCCCGAGGACACAGGGCAGGCTGATGCTCGCTCACTAACTCTTCTGTAGCCTGAGATCTCCTCAGCCTGTGCCTTGTGCATGCATGC

GCGCCCACATGCCCAAATGCACCATTCAGCCAGAAAAGATGACTACAGAACGCAGTCTGTTCAACTTTGTGATTAATATAATAGAAGATGGAAAAACGAG

TCACTAAATAAAGACTTGTTAAACCT
Translation
FPPGSRFKAVAWRPTALGHIE - UNI27291 - IFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQ VTDELLEKIASRSQNIIEINISD

CRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ LGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQR

IYMQENKL - UNI36507 - VTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTK - UNI1431 - - UNI36507 - LRNLSSLDLRHITELD

NETVMEIVKRCKNLSSLNLCLNWIINDR RCVEVIAKEGQNLKELYLVSCKITDYA ALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGL

MRCDK VNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS
Transcript ENSMUST00000024761
Sequence
CGGCCGCCCGATGCCGGCTGCTGCCAGGCCCCGGAGCAGCCCCCGCCGCCGCTCTGCCCCGCGCCCGCCTCTCCCGCCTCAGAGTGTGCCCCCATCGTGG

CCGCCGCCGGGGACACAGTCCGAGCCGGGGGCACCGCCCCCTCGTCTGCCCAGCAGCAGCCCGAGAGCGGCGACGCGGACTGTCAGGAGCCCCCCGAAAA

CCCCTGCGACTGTCACAGGGAGCCGCCCCCCGAGATCCCAGACATCAACCAACTGCCGCCGTCCATCCTGCTTAAG - UNI7930 - - UNI27291 

- ATATTTTCCAATTTGTCCCTGAACGAACGCTGCCTTTCTGCATCGTTGGTTTGCAAGTACTGGCGTGACCTTTGCTTAGATTTCCAGTTTTGGAAGCA

GCTGGACCTTAGTAGTCGTCAGCAG GTTACTGATGAATTATTGGAAAAAATTGCCTCCAGAAGTCAGAATATAATTGAGATTAACATTTCTGATTGTCG

AAGTCTGTCTGACAGTGGCGTGTGTGTCCTAGCATTTAAGTGTCCTGGACTTCTTAGGTATACAGCCTACAGGTGTAAGCAGCTTTCTGACACCTCAATC

ATTGCGGTCGCGTCTCACTGCCCTTTACTGCAGAAAGTCCACGTAGGCAACCAGGACAAGCTCACCGATGAAGGACTTAAGCAG CTGGGCTCAAGATGC

AGAGAACTCAAAGACATCCATTTTGGCCAGTGTTACAAGATCTCAGATGAAGGCATGATTGTCATAGCTAAGAGCTGCCTGAAGTTACAGAGGATATACA

TGCAGGAAAACAAATTA - UNI36507 - GTGACAGATCAGTCAGTGAAGGCATTTGCTGAGCACTGTCCTGAACTCCAGTATGTTGGCTTCATGGGT

TGTTCAGTTACTTCCAAAGGAGTCATTCACTTAACCAAG - UNI1431 - - UNI36507 - CTAAGGAACCTGTCCAGCTTAGACCTCCGTCACAT

CACTGAACTGGATAATGAAACCGTGATGGAAATCGTCAAGAGGTGCAAAAATCTCAGCTCTCTGAATCTCTGTCTGAACTGGATCATAAACGACAG GTG

TGTGGAGGTCATTGCAAAGGAAGGACAGAACCTGAAAGAGCTGTACCTGGTGTCCTGTAAGATCACTGATTATG CACTGATAGCCATTGGGCGATACAG

CGTGACCATAGAGACTGTGGACGTCGGATGGTGTAAAGAAATCACAGATCAAGGAGCCACCCTGATTGCACAGAGCAGCAAGTCCCTGAGATACTTGGGC

CTGATGAGATGTGACAAA GTCAATGAATTGACAGTGGAGCAGCTGGTGCAGCAGTACCCGCACATCACCTTCAGCACCGTTCTGCAGGACTGCAAGAGG

ACCTTGGAGAGAGCCTACCAGATGGGCTGGACCCCCAATATGTCCGCTGCCACCTCCTAACTCTCTTCCTATGCCCAGGTCTACTCAGGCCGGTTCAGCA

GAATGGAGAAATGGGGGGCTCCAATAGGGGGTCTTTCGGAAAGGTTTTAACCGTCACCTGTCAGTGTGTGTACCCGAGTGTTCCGTTTGTGTCTTGTTTG

CATTCTGCATAGCATAAGCGCACTGTTACTTACCCCAAGGTGAGCTGGCTTGTTTTCCCTAAAACAGAAGATTATGAAAACCAGGACCTTTTTGTTTTTT

GTTTTGTTTTCCAATTCAAACGTCTATTTCTCTAAAAAGACTTTGTGGAATCTCAAGTCAGAAAACTGGTTGTATAGTTTTGAGCTTTTAAGTTCTGACA

CATCTCGGAAATGCTCGCAGAAAGGCTTTGTTCGGTGATAGGTAGGCTACTTGTACGCTTCTGAGAAGACCAAAACAGAAGTGATGTTGCTCTAACTAGA

AGCCTGGAGACTAGAACCCCTCAAAATCCTGGAGTACACAGCTAAAGTTCCACTCTCTTGTACTGTCATACACACATGCTAGGTCAGGTTCTCGCTTGGT

AAATTCTTTCCTGCCAGAGGAACCTTCCTGGGTCATGAAGAGAGCATGCCTTCCACTGTGGCTATGCCTAACGTACTGTGCCCAGTGGTGGACAACTTGC

TGTCTTATAGGTAACTTAGGAAGTAGACTGAATAAAGCCTTTTGTAAATTTGTATATGGAGGCAACAGTCTGATGTCCCCTGGCCAGCTCACAAAAGTTA

ATTATTCATTATTCTGTAAATGCATTCTGTTAAGTAATAAATATTTTAGTTGGTTTTGCATTAACACTGTGTTCGCTTTTACTGTGTGGACAGTTACTGG

TCAAGATGCATTTTAGTGACATTTGGGGCTAATCTTGGCATTATTCACATTGAAGCCATGAATGTAATTAATGGTGTGCAGTTATTTTAAAAATTTTACA

GATCATTTCATTATTTTGGTAATTATGAAAATATATTCTGAGGTGGGGTAGTTATTGATAGAAGATTAATGAATGAGATGTATGTAGACAATCTTCCTAT

TGTATTTTTTTCCTTTGCTTTGGGATTGAGAACAGGTTTTTTGAATATATGCATGTTATAATTTTAAATAGTTCTTACACTACTGCAAAGATCTACTGTT

AGCTAACGTATGAGCTAAGGAGAGAATTTAGAAAATCTGTTCATTAAGATTCTGTTTACACTTGCCAGAAATACATATTTTAGTTTAATTAAGTATTACC

AGCTTTTACTTCTGTCAGTACCTATCAGGAAAGGAGTGTAAGTTTTGATGTCACACATTTCTACAGTCAGCCGTTGCAGGGACTCAGGCTCAGATGACCT

CTCCTATGTCTGGATTTATAAGCAGGCAGCAGGGAGCCTTTTTAAGCTAAAGAGTGATTATCTTTCGTAGTAGGAAAAGCAAAACCTTGACTTTTGAACT

TGCTATTTATTCTCCCTGTATGTGGTCTTTGGTCTTTAACAATTATAATGAGGTTTGAGTTTGTTTCCTATAAATCCCAGCCCTGCGGAAGCAATGCTAG

CTGTAGGAGGCAGAAGCTGCCTTCCATTTGCACACCATGCACGTGTGTGTAACAACTCCTTCTCTGTAGAAAAGGTTTGTTTCCCTCCAGTTTGTCAACA

TGCTTCTGATGTGGCAGTTTATTGTTTTAATCCCAATCAGTTAAAAAACAAAAAGTACCTTTTTCATAACCAAATAGGAGATTTTATGTGACATATGTAT

TATTACATCATTACCATAGGAACCAAAGTCTAGTCCCATGGATGTTATTTCCTCTTCCATTTTAATTGAGTCATGAACATGTACCAAAACCAGCTGGCAA

TATGACAGTCATTGCGACTGAAGGGTCAGTTGGAGTCAGGCCTACTATGACTATCGGTAAATAGGAGGTTTTTCCTCTTGGGCACTATGCTTAGAAGATT

AACTCAGCTCTCCTGCGGGATGTTTAATACACGCATTGCCGCTACATGGGACTCTTCAGTCACCAAAACGCAGCCATCTGCAGGAACATATTCCCAAACT

AAAACCATATCTAAGATCCTTCAGCGCCCAGTCCTGTGATCTCCCTTGGCTAATAACGAACTGTAAGGATGCCAGCAGCTCATGAAGAAAGGGAGACTTC

CAAAAGAGCCTGCGTTGTTTGATTCAGCTGTTTTATTCACAACAGGATGGAAGAGACAGTCATGCATTTCTGAAAGTTTTTCCACAGTTTGGCATCACTT

GAAAGATCTGGAGATGAGAAGCATTGATGGAAAGTGGCCCGAGGACACAGGGCAGGCTGATGCTCGCTCACTAACTCTTCTGTAGCCTGAGATCTCCTCA

GCCTGTGCCTTGTGCATGCATGCGCGCCCACATGCCCAAATGCACCATTCAGCCAGAAAAGATGACTACAGAACGCAGTCTGTTCAACTTTGTGATTAAT

ATAATAGAAGATGGAAAAACGAGTCACTAAATAAAGACTTGTTAAACCT
Translation
RPPDAGCCQAPEQPPPPLCPAPASPASECAPIVAAAGDTVRAGGTAPSSAQQQPESGDADCQEPPENPCDCHREPPPEIPDINQLPPSILLK - UNI79

30 - - UNI27291 - IFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQ VTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCP

GLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ LGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKL - UNI365

07 - VTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTK - UNI1431 - - UNI36507 - LRNLSSLDLRHITELDNETVMEIVKRCKNLSSL

NLCLNWIINDR RCVEVIAKEGQNLKELYLVSCKITDYA ALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDK VNELTVEQLVQ

QYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS

For any suggestions or comments, please send an email to unitrap@crg.es