Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000023984 (Usp49)
Chromosomal location
Chr 17: 47767639 - 47821015 (+)
Description
ubiquitin specific peptidase 49 Gene [Source:MGI (curated);Acc:Usp49-001]
RefSeq_dna
NM_198421 
RefSeq_peptide
NP_940813.1 
UniGene
Mm.59393 
MGI
MGI:2685391 
Uniprot/SWISSPROT
Q6P9L4 
Human Ortholog
ENSG00000164663 (USP49)
Omim not available
UniTrap UNI14281
Vector Insertion
Chr 17: 47767865 - 47786898
Public Clones D093G11 (ggtc) CMHD-GT_407H10-3 (cmhd) (cmhd) FHCRC-GT-S21-12D1 (fhcrc) IST14409B5 (tigm)
IST10496H1 (tigm)
Private Clones OST426705 (lexicon) OST414209 (lexicon) OST409161 (lexicon) OST379556 (lexicon)
OST379221 (lexicon) OST379105 (lexicon) OST355821 (lexicon) OST348115 (lexicon)
OST343562 (lexicon) OST287164 (lexicon) OST283309 (lexicon) OST266312 (lexicon)
OST238110 (lexicon) OST109030 (lexicon) OST104840 (lexicon) OST104838 (lexicon)
OST79895 (lexicon) OST62391 (lexicon) OST62368 (lexicon) OST56947 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22544
Vector Insertion
Chr 17: 47810368 - 47811664
Public Clones not available
Private Clones OST292368 (lexicon) OST237835 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28213
Vector Insertion
Chr 17: 47811870 - 47815792
Public Clones CMHD-GT_388D1-3 (cmhd)
Private Clones OST36885 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024779
Sequence
TGGGCCCTGGGAATTAAAGGATGGAATGGGGAGTGGGGAAAGAGAAAGGAGATTAAGGCAAGCTAGGGAAGTCCTGGTGGGTATAGAACTGGGGTGGGCT

GCACAGGAGTGGGAAACGAATGTTTTGCCCTGAAGTGCCCCAGAAGGTCTGGAAGGGGCAGGGCACAAACGCTGTAGTGAAGGATCTGAAGTAGAGAGCC

TTTGGTGCAGAAGATAAGGAACCATG - UNI14281 - GTAACAGAGAAGAGGAAACCCAGCCAGTGATAATGTGAGAATATGGAAGGCGATGGGAGC

AGCTTGTTTAATGG ATTAAGACAGTGGCGACTGCGCTAAAACATGGATAGATGCAAACATGTAGGGCGGTTACGGCTCGCCCAGGACCACTCCATCCTG

AATCCCCAGAAGTGGTGCTGTCTGCAGTGCGCCACCACCGAGTCTGCGTGGGCCTGCCTCAAGTGCTCCCACGTGGCCTGCGGCCGCTACATTGAAGACC

ATGCACTAAAACACTTTGAAGAGACAGGACACCCGCTGGCCATGGAGGTCCGGGACCTCTACGTGTTCTGCTACCTGTGCAAGGACTACGTGCTCAATGA

CAACCCGGAGGGGGACCTGAAGTTGCTGAGAAGCTCCCTCCTGGCAGTTCGAGGCCAGAAGCAGGACCTGCTCGCCAGGCGTGGGCGGACGCTGCGGTCC

ACAGCTGCGGGCGAGGACGTGGTCCCGCCACAGCGCACTCCTCAGGGACAGCCGCAGATGCTCACGGCTCTGTGGTACCGGCGCCAGCGCCTGCTGGCCA

AGACGCTGCGGCTCTGGTTCCAGAAGAGCTCCCGCGGCCGGGCGCAGCTGGAGCAGCGGCGGCAGGAGGAGGCGCTGGAGCGCAAGAAGGAGGCGGCGCG

GCAGCGGCGCCGCGAGGTCAAGCGGCGGCTGCTGGAGGAGCTGGCCAGTGCGCCGCCGCGGAAGAGTGCGCGCCTGCTCCTGCACGCTCCCGGGCCCGTG

GCCGTGCGCCCTGCCACCCTCGCTACCTCCCGGCGCTTGTCCGCAGCTGCCCTCAATCCGCGCCGCCAGCCGGCGGTGGCCCCAGGTGTCACCGGCCTGC

GCAACCTGGGGAATACCTGCTACATGAACTCCATCCTCCAAGTGCTCAGCCACCTCCAGAAGTTCCGGGAATGTTTCCTGAACCTCGACCCTTCCACCTC

CGAGCACCTGTTTCCCCAAGCAACCAACGGGAAGGCGCAGCTCTCTGGTAGGCCAGCCAGCAGCTCTGCCGCAGAGTTGTCAGTAAGGAGTGTCCGGGCC

CAGGGCTGCGAACCTCAGGGCCTCTGCTGGAGCAGCGGAGCCTCCATCAGCAGGAGCCTGGAGCTCATTCAGAACAAGGAACCCAGCTCAAAGCACATTT

CCCTCTGCCACGAACTGCACACCCTCTTCCGAGTCATGTGGTCTGGGAAGTGGGCGCTGGTATCACCCTTTGCCATGCTTCACTCCGTGTGGAGCCTGAT

TCCCGCCTTCCGTGGCTACGACCAGCAGGATGCGCAGGAATTTCTCTGCGAACTGCTGCACAAGGTGCAGCAGGAACTTGAGTCTGAGGGTTCCACACGC

AGGATCCTCATCCCATTCTCCCAGAGGAAGCTCACCAAACAGGTCTTAAAGGTGGTGAACACCATATTTCATGGGCAGCTGCTCAGTCAG - UNI2254

4 - GTCACATGTATATCATGCAATTATAAATCCAATACCATTGAGCCCTTTTGGGATCTGTCCCTGGAATTCCCTGAACGATACCACTGCATAGAAAAG

GGGTTTGTCCCTTTGAATCAGACAGAGTGCCTGCTCACTGAGATGCTAGCCAAGTTCACCGAGACAGAGGCCCTGGAGGGGAGAATCTACGCTTGTGACC

AGTGTAACA - UNI28213 - GCAAACGACGAAAGTCCAACCCCAAACCCCTTGTTCTGAGTGAAGCTAGGAAGCAGTTAATGATCTACAGACTACCT

CAGGTCCTCCGGCTACACCTTAAAAGATTCAG GTGGTCTGGCCGTAACCATCGTGAGAAGATTGGGGTCCATGTCATCTTTGACCAGGTATTAACCATG

GAACCTTACTGCTGCAGGGACATGCTCTCCTCTCTTGACAAAGAGACCTTTGCCTATGATCTCTCCGCAGTGGTCATGCATCACGGGAAAGGGTTTGGCT

CAGGACACTACACAGCCTATTGCTACAACACAGAGGGAG GTTTTTGGGTCCACTGCAATGACTCAAAGCTGGATGTATGCAGTGTCGAGGAAGTGTGCA

AAACCCAGGCCTACATTCTTTTTTACACTCGAAGAACAGTTCAGGGCAGCGCAAAACTCTCAGAACCCCATCTCCAAGCTCAGGTGCACTCCAGCAGCAA

GGACGAACGCAGAACATACACATTGCCCTGACTGGGAGGCAAGCATCAAAACGGCCTCCAGGTCTCCTCTTGGGCTTGCCAGGAACAGATCCCTGGGTTT

GCCTCACTGGTCTAGGGGAGACAATGCCCTATGATTCCTGCTCTGTCAAAAAATTGGTAGTCACTTTCTTGTGAAACCATGCAAATCCCCTTCTCTCATA

AAAACACTATAAAGGAGCAGCTTCTATGAAGATCCTTTTGTCAGTTGCTTCTGGATAACAGGGATCTGGGTAGAGGAGACAGGGTAAGTCATCAGCCAAC

CAGGAGAGCAAGCATGTCTGTCTCTGTTGTGAGTCCCCTACTAATGAGGCCCTTCCCAAAGCACTGCACAGAGTACATGAGGCCCTGGGCTGACAGCTGG

CGGGAAAGACCGGTTCTGACTCAGGTGAAGTCACAGGAGTTACTCACACTAAAAAGGTAATATACCATCCAGGGGCATAGCTTGCAGACTTTCTTTTTTA

GGAGAGAGCAGCTGAAGGGTGAGGGGCAAGGAGCAGACTTCCTCCATGCCAATGGGAAGGCTGTCTGTCATGGCTCAGTTTCTCCTGAACTGCTGTCACC

TCATCACTCCACACAGCGAGGCCGAGGCTTGAGCCACCCCTTCCTTCAGAAGAGGCAGTCAGAAGGACACAGACCTGTGTGTGCATGGTCTATACGTGTT

ATGCCGTGGACACTCCTGACTTCCCCAGTCCTGTAGCAAGGCCTGGGCTCAAAGTCATGGTTTGGTTTAGATTGGTTTTTGGATCAGTTGTCAGAAGCCT

TCTCAGAATGCAGTGAAGATGAGATGAGCTTGTCTGAATGCCTGCTGTCCCTAAGGCTGCCCCTAAGGTCCCGCCCACCTGTGTGGCATGAAGCTTCGTT

CTTGCCCCTAGAACATCAGTGCCCACAGGCTTCAGGAGCTTTTACTGCCCTAGTGTGTGAGCAGTGCTTAGGGACTGACTGGATCGTTTGCTTGTGGCCC

TTGCCTGCTGTATCCCAGCGCTGTTTATCCACCTCTGCTGCTTTGTCCGTGAGGAATAGAGCAAGACTCGTCTGTTACTCTGGTATTAGTGAAAACACAT

CTCTAAAATTGACTCCATCTCTATGGGATTCAGGTGCTCAGAGCCTTCCTCCCTATCAGGCACAGTAAGCTTCTTTCTCTTTGCAGTGGCTACTGCAGTG

CCCCACAGCCTCCCGTGAATGCTCTCTTTTGGTTAAGTAGCTCGGGTTAACGTTTGAGCTCAGGCAGAGCAGTTATCACTCAATGGGGGGAGGCAACGGA

GGCATGGCCACACTTCAGGCACATCTGTGGTATTTACTGCTGTTCTCCTTTGAGGTGAGCTCTCAGTGGGCCTGCCAGACATCAGACATGGAAGAAATCA

GAGTGGCTCATCCTGATAGGGACGACGTGCTGGATTCAAACAACACTGTGAGGTTTCTGTAGTATTTAGCTTTTCTTTGGAAGCGATACCGTAAGGCATT

TTTGTGCTGTTTGGTTTTTACTGTCTGTGGCAGGCTTTTCTGTGAGCTTTGCTCAGGCTCCTCCTCTCCTGGACACTGTTGTCAGGTGTCCCAGTTGCCC

ACACTGCCTGAGGCTCTGACGTAAAGCTGTACCCCTTCAGGGAGGCCGACATTACTAGCACAGCATGACGGTGATGATTTGTTACCACTGTAGGAAAGCC

CATTCAAAAAGAAAGCCATGTGTGCTGGAACACTCCTGTAAGGCCAGCACTTGTCAGGCTGAGGCAGGAGGATCATGAGTTTGAAGCTACACTGTGAGGC

CCTGTTTGAAAAACAAAACTAGCAAACTAGTGAAAAGGACTGGATTGCACCTCACCTGAAACCCTGTGTTGTTTATTCCAGAAAGAGAATTTGCAGGCAG

AGAATACAGATCTGCCTGTCTAGAGGGGAAACACATTAATCACTATAAACACCTACAGGAACATTAAAGGATTCTTACCCAACTTTTAAGAAGAGTTTTA

TAGCAGCTATCAGCAGGACTGGTAAGCAGATTAGGGACCTAATAAAAAAAATGCTTAACTGACCTGAACACCTACATATGAGATTAGTAAAATTACTTAG

TCAGAAGTGAAACCAACTGTCCCCACTGAGCCACCCACATGAAGGTGCCACTGCAACCACAGATGACACCTCAGCTCCAGGAGCAGCAGCTCGAGTTAGG

GGTGTGGTGCTTAAGGAGAGCTCTGCTGCAGAAGGGCAGGGCAGGGCAGGGCAGGGCAGGGCTGCTGCGGTACTACATAGCCAAAGCAGAGCGCTGTGTC

AGATGCATCACAGTGAAACATCCTAAAAACAAAGGACAGACAGACAGACCCTGACTAGCTGACTCCAGGACATACCCCCAGTGCTGCTCTCCCGGCTGCA

GTCTCCTGAACGCTGTGATTGGCTGGTGTGTTTACTTACTGCTGTAACCAGCCAAGATGAATTCACCCCAGCCCTCAAAAATGACTTCTTACCTCAGTCT

AGCCTGGCCCTCATGCTTGTGGTCGCCTCTAAGAGCAGCACCCATTACTAGTGCAAAACCAGCAGGGCTAGCCTTGGCACCAGGAACTGTAGCTCTCATC

CCATGGCAGGCAGAGCTCTTGCCAGCTTTAACCCAGCCCCTCTGGCTGAGATGGGAGGGCAATGCCACATAGTGAAGAACTTTTAGATGTCTCTTAAAAC

GTCAAGAATAAGACTGGAAACTGTAGAAGAGTTAATGTGTCCTATGGACTCAATAGCAGAGTTTATTTTTGTTCACAGTGGCAAGGCCTCTCGAGTCCAT

GATTGTATGAGGTCCCTGCTCTGGCTATGCCTTCAGCTCCATCCACATTCAGGGGACGAACCAATGAGGTGGACTGGCCGGCAGTGCCCGAGTAAGCCGA

GAGGTCCATGGTGAAGAATGAAAACTTTGGGGGCGGGGGGTGGGAGGATATCTGATATTTGTTTTACTGATAAAGCTTTGTGAACTAATTTTCTACAATT

CATAAAATTTGGTGCCTTGTACTTGATTGTGGTTTGCATGAGAGTTAAGGGGAGGGCTCCTTTTCGTTATGGGTCTGTAGTGTTTAAAGGATACGTGCTA

TCAGATTTTTAGAGCATTCCTTTCTTTGTCTTATTACGAATGTAAATTGTTCTTACCAGCAAGTTCTAGAGTTTTACTGTCCAAACTGTATTTGTAATCA

ATCATTCATCAAATGTCTGACTACT
Translation
 - UNI14281 -  MDRCKHVGRLRLAQDHSILNPQKWCCLQCATTESAWACLKCSHVACGRYIEDHALKHFEETGHPLAMEVRDLYVFCYLCKDYVLN

DNPEGDLKLLRSSLLAVRGQKQDLLARRGRTLRSTAAGEDVVPPQRTPQGQPQMLTALWYRRQRLLAKTLRLWFQKSSRGRAQLEQRRQEEALERKKEAA

RQRRREVKRRLLEELASAPPRKSARLLLHAPGPVAVRPATLATSRRLSAAALNPRRQPAVAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPST

SEHLFPQATNGKAQLSGRPASSSAAELSVRSVRAQGCEPQGLCWSSGASISRSLELIQNKEPSSKHISLCHELHTLFRVMWSGKWALVSPFAMLHSVWSL

IPAFRGYDQQDAQEFLCELLHKVQQELESEGSTRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQ - UNI22544 - VTCISCNYKSNTIEPFWDLSLE

FPERYHCIEKGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNS - UNI28213 - SKRRKSNPKPLVLSEARKQLMIYRLPQVLRLHLKRFR R

WSGRNHREKIGVHVIFDQVLTMEPYCCRDMLSSLDKETFAYDLSAVVMHHGKGFGSGHYTAYCYNTEGG GFWVHCNDSKLDVCSVEEVCKTQAYILFYT

RRTVQGSAKLSEPHLQAQVHSSSKDERRTYTLP

For any suggestions or comments, please send an email to unitrap@crg.es