Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024002 (Brd4)
Chromosomal location
Chr 17: 32333219 - 32421054 (-)
Description
bromodomain containing 4 Gene [Source:MGI (curated);Acc:Brd4-003]
RefSeq_dna
NM_198094 
RefSeq_peptide
NP_932762.1 NP_065254.2 
UniGene
Mm.253518 Mm.395253 
MGI
MGI:1888520 
Uniprot/SWISSPROT
Q9ESU6 
Uniprot/SPTREMBL
B0V2V6 B2RSE4 Q3SYK2 Q3U3Z2 Q63ZX2 B0V2V8 B0V2V7 O35692 Q8BS78 Q3UH70 
Human Ortholog
ENSG00000141867 (BRD4)
Omim not available
UniTrap UNI8959
Vector Insertion
Chr 17: 32421007 - 32421043
Public Clones RRE255 (baygenomics) XC684 (baygenomics) RST523 (baygenomics) XG379 (baygenomics)
W272D01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16468
Vector Insertion
Chr 17: 32390146 - 32421007
Public Clones (sanger) P136C07 (ggtc) D088B07 (ggtc) P145F08 (ggtc) P121G05 (ggtc)
D042H07 (ggtc) P141G09 (ggtc) P103G10 (ggtc) D014D09 (ggtc) P131H04 (ggtc)
P144G12 (ggtc) P120D04 (ggtc) P099G11 (ggtc) 3SP141H01 (ggtc) D046D03 (ggtc)
D027F12 (ggtc) IST14583D6 (tigm) IST14218C11 (tigm) IST14828D10 (tigm)
IST14424C1 (tigm) IST14612C5 (tigm) IST14865G3 (tigm) IST14516F4 (tigm)
IST13061G9 (tigm)
Private Clones OST460314 (lexicon) OST456001 (lexicon) OST424920 (lexicon) OST367747 (lexicon)
OST346741 (lexicon) OST318204 (lexicon) OST285510 (lexicon) OST283825 (lexicon)
OST281372 (lexicon) OST270969 (lexicon) OST246263 (lexicon) OST224640 (lexicon)
OST195300 (lexicon) OST194245 (lexicon) OST193976 (lexicon) OST193586 (lexicon)
OST142486 (lexicon) OST130448 (lexicon) OST128725 (lexicon) OST110516 (lexicon)
OST108374 (lexicon) OST107992 (lexicon) OST104618 (lexicon) OST101473 (lexicon)
OST67327 (lexicon) OST66712 (lexicon) OST58079 (lexicon) OST45307 (lexicon)
OST43344 (lexicon) OST35685 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5569
Vector Insertion
Chr 17: 32389985 - 32390146
Public Clones YTA250 (baygenomics) RRN086 (baygenomics) P095G08 (ggtc) D042B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29490
Vector Insertion
Chr 17: 32366361 - 32390146
Public Clones D042B04 (ggtc) P139E06 (ggtc) P095G08 (ggtc) IST14535B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23478
Vector Insertion
Chr 17: 32366361 - 32366681
Public Clones CMHD-GT_536F6-3 (cmhd)
Private Clones OST257945 (lexicon) OST223918 (lexicon) OST214593 (lexicon) OST206060 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13518
Vector Insertion
Chr 17: 32362659 - 32366361
Public Clones CMHD-GT_302C7-3 (cmhd)
Private Clones OST242644 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27535
Vector Insertion
Chr 17: 32361168 - 32362520
Public Clones not available
Private Clones OST57339 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4057
Vector Insertion
Chr 17: 32351786 - 32357105
Public Clones AQ0292 (sanger)
Private Clones OST450429 (lexicon) OST14489 (lexicon) OST1582 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14985
Vector Insertion
Chr 17: 32348111 - 32350080
Public Clones PST4266-NL (escells) PSTVU01.HE2U (vanderbilt) PSTVU01.E415 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6785
Vector Insertion
Chr 17: 32343941 - 32348111
Public Clones YHA429 (baygenomics) RRJ061 (baygenomics) W044D04 (ggtc) PST4435-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2231
Vector Insertion
Chr 17: 32335508 - 32335627
Public Clones AS0512 (sanger) AD0200 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2664
Vector Insertion
Chr 17: 32334766 - 32334975
Public Clones AL0566 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114475
Sequence
GGAGGAGGAAGCGACTGCCTCTGGATCTGCGGTGCGCGCCGGGCCGC - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 - CC

AACAAGATAGCTGTGTTCCAGTTTTGTTCAAAACTACTAGTGAAGAAGTCCTCCTCTCCTCTCATTCCCATATCTGCTTTCCGTCTGGACACAACATTGG

GTCTAAGAAAATCAGCTCACCAGGCTGTGACCACTGAATCACATTGGAGTTCTCTGTA - UNI5569 - - UNI23478 - - UNI29490 - AGT

GCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTACGGAGAGCGGCCCTGGGACAAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACC

TCCCAAATGTCTACAACGCAGGCCCAGGCCCAACCCCAGCCAGCAAATGCAGCCAGCACCAATCCTCCACCCCCAGAGACCTCCAACCCTAACAAGCCCA

AGAGACAGACAAACCAACTGCAATATCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCGTGGCCTTTCCAGCAGCCCGTGGATGCCGT

CAAGCTGAACCTCCCT - UNI13518 - - UNI23478 - - UNI29490 - GATTACTATAAGATTATTAAAACACCCATGGATATGGGAACAAT

AAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTATAACAAG - UNI

27535 - CCTGGAGATGACATCGTCTTAATGGCAGAAGCTCTGGAGAAGCTCTTCTTGCAAAAAATCAATGAACTGCCTACAGAAGAAACTGAGATCAT

GATAGTCCAGGCAAAAGGAAGAGGACGAGGGAGGAAAGAAACAG GGGCAGCAAAGCCTGGTGTATCCACGGTACCAAACACAACTCAAGCATCAACTTC

TCCGCAGACCCAGACGCCTCAGCAGAACCCTCCTCCACCTGTGCAGGCCACAACTCACCCCTTTCCTGCTGTCACCCCAGACCTCATTGCCCAGCCTCCT

GTCATGACAATGGTGCCCCCTCAGCCACTTCAGACTCCTTCACCGGTACCCCCCCAGCCACCACCCCCACCTGCTCCAGTTCCACAGCCTGTGCAGAGTC

ACCCGCCCATCATTGCGACCACCCCCCAGCCTGTGAAG ACAAAGAAAGGGGTGAAGAGGAAAGCAGATACCACCACCCCTACCACCATCGACCCCATTC

ATGAGCCACCCTCACTGGCCCCAGAGCCCAAGACCGCCAAGCTGGGTCCTCGGCGGGAGAGCAGCAGACCTGTGAAGCCTCCAAAGAAGGATGTACCGGA

CTCACAGCAGCACCCAGGGCCAGAGAAGAGCAGCAAGATCTCTGAGCAGCTAAAGTGCTGCAGTGGCATCCTCAAGGAGATGTTTGCCAAGAAACATGCT

GCCTATGCCTGGCCTTTCTACAAGCCTGTGGATGTGGAGGCACTGGGTCTGCACGACTACTGTGACATCATCAAACATCCCATGGACATGAGCACAATCA

AG TCTAAACTAGAGTCCCGAGAGTACAGAGATGCCCAGGAATTTGGTGCTGATGTCCGATTGATGTTCTCCAACTGCTACAAGTACAACCCCCCTGACC

ATGAAGTGGTAGCCATGGCTCGAAAACTCCAG - UNI4057 - GATGTGTTTGAAATGCGCTTTGCCAAGATGCCTGATGAGCCTGAAGAGCCAGTTG

TTACAGTGTCCTCTCCTGCAGTGCCACCCCCTACAAAGGTGGTAGCCCCACCCTCATCTAGTGACAGCAGCAGCGACAGTTCTTCCGACAGCGACAGTTC

CACTGACGACTCTGAGGAAGAGCGAGCCCAGCGGCTGGCTGAACTCCAGGAACAG CTCAAGGCCGTGCATGAGCAGCTTGCAGCCCTCTCACAGCCCCA

GCAGAACAAACCAAAGAAAAAGGAGAAGGACAAGAAGGAAAAGAAAAAGGAAAAGCACAAAAAGAAAGAAGAAGTGGAGGAAAATAAAAAAAGCAAAACC

AAGGAACTTCCTCCCAAAAAGACAAAGAAAAATAACAGCAGCAACAGCAATGTGAG - UNI14985 - CAAGAAGGAACCAGTACCCACGAAGACCAA

GCCGCCTCCCACATATGAATCAGAAGAGGAGGATAAGTGTAAGCCCATGTCTTATGAGGAGAAGCGGCAGCTAAGTCTAGATATCAACAAACTTCCTGGT

GAGAAGCTAGGCCGTGTAGTACACATAATTCAGTCAAGGGAACCATCACTTAAAAACTCCAACCCCGATGAGATTGAGATTGACTTTGAGACCCTGAAGC

CATCTACACTACGAGAGTTGGAGCGATATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG - UNI14985 - CTGAAAAAGTTGACGTGATT

GCTGGTTCTTCCAAGATGAAGGGATTCTCATCCTCTGAGTCGGAGAGCACCAGCGAATCCAGCTCCTCTGACAGTGAAGACTCTGAAACAG - UNI678

5 - - UNI14985 - GTCCTGCCTAATCATTGGACACGGACTCTTAATAAAACGGTCTTCAGTTCCAGATTCCTTCCCAGCGAGCTATAGCTTAAGTC

CCATTTTCTTCTGTGAAAGGGACAGGACTCCATCAAGTTATGGAATTGCTCAGAGCCCTGGGCCTATCCCCTGGGGTGGATTAGTCATGTCCAGCAGCAC

ACACCTAGTTTCACCTTCAGGAAGGCTGCCTGCCTGGCCTGCTGCCTGGGCCTCTCTGTACAAAGACTGCCTGGCTATCCTGCCCAGCCTCCCTGGTCAT

CTGGGGTCCTCTGGGTGGGTGGCATCTCCTAGAGGGTGATAA
Translation
 - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 -  - UNI5569 - - UNI23478 - - UNI29490 - MSTESGPGTR

LRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP - UNI13518 - -

 UNI23478 - - UNI29490 - DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK - UNI27535 - PGDDIVLMAEALEKL

FLQKINELPTEETEIMIVQAKGRGRGRKETG GAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPV

PPQPPPPPAPVPQPVQSHPPIIATTPQPVK TKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISE

QLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK SKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ - U

NI4057 - DVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQ LKAVHEQLAALSQPQQNKPK

KKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVS - UNI14985 - SKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDI

NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA - UNI14985 - AEKVDVIAGSSKMKGFSSSESESTS

ESSSSDSEDSETG - UNI6785 - - UNI14985 - GPA
Transcript ENSMUST00000120276
Sequence
GGAGGAGGAAGCGACTGCCTCTGGATCTGCGGTGCGCGCCGGGCCGC - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 - CC

AACAAGATAGCTGTGTTCCAGTTTTGTTCAAAACTACTAGTGAAGAAGTCCTCCTCTCCTCTCATTCCCATATCTGCTTTCCGTCTGGACACAACATTGG

GTCTAAGAAAATCAGCTCACCAGGCTGTGACCACTGAATCACATTGGAGTTCTCTGTA - UNI5569 - - UNI23478 - - UNI29490 - AGT

GCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTACGGAGAGCGGCCCTGGGACAAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACC

TCCCAAATGTCTACAACGCAGGCCCAGGCCCAACCCCAGCCAGCAAATGCAGCCAGCACCAATCCTCCACCCCCAGAGACCTCCAACCCTAACAAGCCCA

AGAGACAGACAAACCAACTGCAATATCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCGTGGCCTTTCCAGCAGCCCGTGGATGCCGT

CAAGCTGAACCTCCCT - UNI13518 - - UNI23478 - - UNI29490 - GATTACTATAAGATTATTAAAACACCCATGGATATGGGAACAAT

AAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTATAACAAG - UNI

27535 - CCTGGAGATGACATCGTCTTAATGGCAGAAGCTCTGGAGAAGCTCTTCTTGCAAAAAATCAATGAACTGCCTACAGAAGAAACTGAGATCAT

GATAGTCCAGGCAAAAGGAAGAGGACGAGGGAGGAAAGAAACAG GGGCAGCAAAGCCTGGTGTATCCACGGTACCAAACACAACTCAAGCATCAACTTC

TCCGCAGACCCAGACGCCTCAGCAGAACCCTCCTCCACCTGTGCAGGCCACAACTCACCCCTTTCCTGCTGTCACCCCAGACCTCATTGCCCAGCCTCCT

GTCATGACAATGGTGCCCCCTCAGCCACTTCAGACTCCTTCACCGGTACCCCCCCAGCCACCACCCCCACCTGCTCCAGTTCCACAGCCTGTGCAGAGTC

ACCCGCCCATCATTGCGACCACCCCCCAGCCTGTGAAG ACAAAGAAAGGGGTGAAGAGGAAAGCAGATACCACCACCCCTACCACCATCGACCCCATTC

ATGAGCCACCCTCACTGGCCCCAGAGCCCAAGACCGCCAAGCTGGGTCCTCGGCGGGAGAGCAGCAGACCTGTGAAGCCTCCAAAGAAGGATGTACCGGA

CTCACAGCAGCACCCAGGGCCAGAGAAGAGCAGCAAGATCTCTGAGCAGCTAAAGTGCTGCAGTGGCATCCTCAAGGAGATGTTTGCCAAGAAACATGCT

GCCTATGCCTGGCCTTTCTACAAGCCTGTGGATGTGGAGGCACTGGGTCTGCACGACTACTGTGACATCATCAAACATCCCATGGACATGAGCACAATCA

AG TCTAAACTAGAGTCCCGAGAGTACAGAGATGCCCAGGAATTTGGTGCTGATGTCCGATTGATGTTCTCCAACTGCTACAAGTACAACCCCCCTGACC

ATGAAGTGGTAGCCATGGCTCGAAAACTCCAG - UNI4057 - GATGTGTTTGAAATGCGCTTTGCCAAGATGCCTGATGAGCCTGAAGAGCCAGTTG

TTACAGTGTCCTCTCCTGCAGTGCCACCCCCTACAAAGGTGGTAGCCCCACCCTCATCTAGTGACAGCAGCAGCGACAGTTCTTCCGACAGCGACAGTTC

CACTGACGACTCTGAGGAAGAGCGAGCCCAGCGGCTGGCTGAACTCCAGGAACAG CTCAAGGCCGTGCATGAGCAGCTTGCAGCCCTCTCACAGCCCCA

GCAGAACAAACCAAAGAAAAAGGAGAAGGACAAGAAGGAAAAGAAAAAGGAAAAGCACAAAAAGAAAGAAGAAGTGGAGGAAAATAAAAAAAGCAAAACC

AAGGAACTTCCTCCCAAAAAGACAAAGAAAAATAACAGCAGCAACAGCAATGTGAG - UNI14985 - CAAGAAGGAACCAGTACCCACGAAGACCAA

GCCGCCTCCCACATATGAATCAGAAGAGGAGGATAAGTGTAAGCCCATGTCTTATGAGGAGAAGCGGCAGCTAAGTCTAGATATCAACAAACTTCCTGGT

GAGAAGCTAGGCCGTGTAGTACACATAATTCAGTCAAGGGAACCATCACTTAAAAACTCCAACCCCGATGAGATTGAGATTGACTTTGAGACCCTGAAGC

CATCTACACTACGAGAGTTGGAGCGATATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG - UNI14985 - CTGAAAAAGTTGACGTGATT

GCTGGTTCTTCCAAGATGAAGGGATTCTCATCCTCTGAGTCGGAGAGCACCAGCGAATCCAGCTCCTCTGACAGTGAAGACTCTGAAACAG - UNI678

5 - - UNI14985 - AGGTCCTGCCTAATCATTGGACACGGACTCTTAATAAAACGGTCTTCAGTTCCAGATTCCTTCCCAGCGAGCTATAGCTTAAG

TCCCATTTTCTTCTGTGAAAGGGACAGGACTCCATCAAGTTATGGAATTGCTCAGAGCCCTGGGCCTATCCCCTGGGGTGGATTAGTCATGTCCAGCAGC

ACACACCTAGTTTCACCTTCAGGAAGGCTGCCTGCCTGGCCTGCTGCCTGGGCCTCTCTGTACAAAGACTGCCTGGCTATCCTGCCCAGCCTCCCTGGTC

ATCTGGGGTCCTCTGGGTGGGTGGCATCTCCTAGAGGGTGATAATAATCCTCCTCTATGCATACATGTGGTGCTGCTCTGTGTGCAAAGCCTGATCACAG

TGTGTTTCCTCTCTTCGTCCCTTCCATCTTTTTCTGAGACTCCAGACCTTGCAGTGACTTTAGCCCAGGAAAGCTAATTCACCGGGAGGATGAACATTGT

GACCTCCCATGTGGGGCCACCCTGGTTGGCTTGATCAGATGGAAGCTGTGACCAGCTTTACCTGGCACGTAGCCTCCTGAATTCTCCTTCAGTCTCTGTT

GTTCCCGTAGAGTACTAAAAGTTCAAGTAACCCAGTGAACACTTCCCCAAGTTCTTTGGTCTTCTCTCCTCATCACATAAGAAAAATAAATAAATACCTT

TCAAGGTTGCTGGGGAGGGACATGCAGCCCCACTGCCAAACCAGGTCAGGATCTGGGAAGTGGGCAAGAAAAATTACATGGCTACTTGTGAACTGCCTAC

AGTGCCTCAACAAGTTCCGTTGCCATCACGGCCATCCTCATCTTTAGCTTCCAATAATGACAGCAGCTGTTGAGGCAAGAATAGACCATATCATCCAAAC

CTTTCCAGAAACAAACCAAAGTAGGTTGGGGCGTTTGTTTGTTTGTTTGGGGTTTGTTTTGTTTTTCTTCCCTGAAATCTGGCCCTGGCCCTTTTTTTTT

TTTTTTTTTTTTTTTTTTTAATCACAGATCTAGCACCCCACCAGAAAACTGCCTGACATAAAAAGCCCCATTTAGTGGGTTCTTTCTGTCTTTTTTCTTT

TTTTCCTTAATGTACTTCTGAGAGAACTGTCTCAGACACCTTGGAGCTTGTCTTCCCCTGGGGCTAAAATGAGACTGTGGTGGTGCCAAGTACCTTCCCA

GATTCCAGAGTTTCCATATTCAAGGGTTGCTTGCTGCCCTCTATCTGATATGACCTTTGGGTCTCAGACTCCCTAGAACATCCAGTGACCCCCCCCCCCC

AAGATGCTGCTGCTGAGTTCTTAGGCCATTCCAAGTCCTCTGTGTGTGTCTCTATCTTCAAGATAGCTCCTTTTGCCAAATGTACTATTTTGAGCTGCCC

TTTGGCCTGTGCCTGACGTATTCCCAATGAACTTGGCTTGGCTGGAATTGGGGGGAAAGGAGACTTCTTGCCCAGAGATTCCCACAGGACAGTTGGGAAA

ACTGTTGGCATTATCTTTCTGGGAAGCTTTTGCTATCTTGGACCAAATGGTGGCCTATATTCCCACCGTATCTTGGCTATGTGCCTCCCTTGCCCCTCCC

AACACCCTGTCTACACACGTGCATACATACAGGGCAACTTTCCCTGTAGAGTACTCTTTGCTATCATGAATCCCATCCCTGGCTATGTGTGCCTACTGTG

ATAGGAACACTCAGGACCTGTTGAACTTGAAAGATCTTTAGGCTTAAAGGTTGTACTTGGTACCCTGGAAACACAGGCAGAAAGGACAGTGTCCCACCTG

TTCTTCCTTGTTGGTAGTTTTCTGTTCCCGGGCAATGGGAGGTCCCCTTGGAAAGCCTTAGTATACCAGCTGGGATCCTGTTGGGGAGCCAGCAAGGATA

GTGGAGGGCTTCTCTCCTTAATTGCCCTGCCCTTAAACCTGTCTCCTTCATTCAAGTGGGGCCGGGCTGGGGTTGAAATCAGTGTTTTAATCCAAGTTTA

CAAAAATCATTTTACTTTGTACAATACCATCCTATGTAAAGATGAAATTTGTGTTGGAGTCTAAGATTGTTATGGAATAAAGATGACACAGTGTTTGAGG

CCA
Translation
 - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 -  - UNI5569 - - UNI23478 - - UNI29490 - MSTESGPGTR

LRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP - UNI13518 - -

 UNI23478 - - UNI29490 - DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK - UNI27535 - PGDDIVLMAEALEKL

FLQKINELPTEETEIMIVQAKGRGRGRKETG GAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPV

PPQPPPPPAPVPQPVQSHPPIIATTPQPVK TKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISE

QLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK SKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ - U

NI4057 - DVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQ LKAVHEQLAALSQPQQNKPK

KKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVS - UNI14985 - SKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDI

NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA - UNI14985 - AEKVDVIAGSSKMKGFSSSESESTS

ESSSSDSEDSETE - UNI6785 - - UNI14985 - EVLPNHWTRTLNKTVFSSRFLPSEL
Transcript ENSMUST00000121285
Sequence
GGAGGAGGAAGCGACTGCCTCTGGATCTGCGGTGCGCGCCGGGCCGC - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 - CC

AACAAGATAGCTGTGTTCCAGTTTTGTTCAAAACTACTAGTGAAGAAGTCCTCCTCTCCTCTCATTCCCATATCTGCTTTCCGTCTGGACACAACATTGG

GTCTAAGAAAATCAGCTCACCAGGCTGTGACCACTGAATCACATTGGAGTTCTCTGTA - UNI5569 - - UNI23478 - - UNI29490 - AGT

GCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTACGGAGAGCGGCCCTGGGACAAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACC

TCCCAAATGTCTACAACGCAGGCCCAGGCCCAACCCCAGCCAGCAAATGCAGCCAGCACCAATCCTCCACCCCCAGAGACCTCCAACCCTAACAAGCCCA

AGAGACAGACAAACCAACTGCAATATCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCGTGGCCTTTCCAGCAGCCCGTGGATGCCGT

CAAGCTGAACCTCCCT - UNI13518 - - UNI23478 - - UNI29490 - GATTACTATAAGATTATTAAAACACCCATGGATATGGGAACAAT

AAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTATAACAAG - UNI

27535 - CCTGGAGATGACATCGTCTTAATGGCAGAAGCTCTGGAGAAGCTCTTCTTGCAAAAAATCAATGAACTGCCTACAGAAGAAACTGAGATCAT

GATAGTCCAGGCAAAAGGAAGAGGACGAGGGAGGAAAGAAACAG GGGCAGCAAAGCCTGGTGTATCCACGGTACCAAACACAACTCAAGCATCAACTTC

TCCGCAGACCCAGACGCCTCAGCAGAACCCTCCTCCACCTGTGCAGGCCACAACTCACCCCTTTCCTGCTGTCACCCCAGACCTCATTGCCCAGCCTCCT

GTCATGACAATGGTGCCCCCTCAGCCACTTCAGACTCCTTCACCGGTACCCCCCCAGCCACCACCCCCACCTGCTCCAGTTCCACAGCCTGTGCAGAGTC

ACCCGCCCATCATTGCGACCACCCCCCAGCCTGTGAAG ACAAAGAAAGGGGTGAAGAGGAAAGCAGATACCACCACCCCTACCACCATCGACCCCATTC

ATGAGCCACCCTCACTGGCCCCAGAGCCCAAGACCGCCAAGCTGGGTCCTCGGCGGGAGAGCAGCAGACCTGTGAAGCCTCCAAAGAAGGATGTACCGGA

CTCACAGCAGCACCCAGGGCCAGAGAAGAGCAGCAAGATCTCTGAGCAGCTAAAGTGCTGCAGTGGCATCCTCAAGGAGATGTTTGCCAAGAAACATGCT

GCCTATGCCTGGCCTTTCTACAAGCCTGTGGATGTGGAGGCACTGGGTCTGCACGACTACTGTGACATCATCAAACATCCCATGGACATGAGCACAATCA

AG TCTAAACTAGAGTCCCGAGAGTACAGAGATGCCCAGGAATTTGGTGCTGATGTCCGATTGATGTTCTCCAACTGCTACAAGTACAACCCCCCTGACC

ATGAAGTGGTAGCCATGGCTCGAAAACTCCAG - UNI4057 - GATGTGTTTGAAATGCGCTTTGCCAAGATGCCTGATGAGCCTGAAGAGCCAGTTG

TTACAGTGTCCTCTCCTGCAGTGCCACCCCCTACAAAGGTGGTAGCCCCACCCTCATCTAGTGACAGCAGCAGCGACAGTTCTTCCGACAGCGACAGTTC

CACTGACGACTCTGAGGAAGAGCGAGCCCAGCGGCTGGCTGAACTCCAGGAACAG CTCAAGGCCGTGCATGAGCAGCTTGCAGCCCTCTCACAGCCCCA

GCAGAACAAACCAAAGAAAAAGGAGAAGGACAAGAAGGAAAAGAAAAAGGAAAAGCACAAAAAGAAAGAAGAAGTGGAGGAAAATAAAAAAAGCAAAACC

AAGGAACTTCCTCCCAAAAAGACAAAGAAAAATAACAGCAGCAACAGCAATGTGAG - UNI14985 - CAAGAAGGAACCAGTACCCACGAAGACCAA

GCCGCCTCCCACATATGAATCAGAAGAGGAGGATAAGTGTAAGCCCATGTCTTATGAGGAGAAGCGGCAGCTAAGTCTAGATATCAACAAACTTCCTGGT

GAGAAGCTAGGCCGTGTAGTACACATAATTCAGTCAAGGGAACCATCACTTAAAAACTCCAACCCCGATGAGATTGAGATTGACTTTGAGACCCTGAAGC

CATCTACACTACGAGAGTTGGAGCGATATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG - UNI14985 - CTGAAAAAGTTGACGTGATT

GCTGGTTCTTCCAAGATGAAGGGATTCTCATCCTCTGAGTCGGAGAGCACCAGCGAATCCAGCTCCTCTGACAGTGAAGACTCTGAAACAG - UNI678

5 - - UNI14985 - AGATGGCTCCCAAGTCAAAAAAGAAGGGGCACACTGGGAGGGACCAGAAAAAG CATCATCACCATCACCATCCACAGATGCA

GCCAGCCCCAGCTCCTGTGCCCCAGCAGCCGCCCCCACCTCCACAGCAGCCTCCTCCACCCCCACCTCCGCAGCAGCAGCAGCAGCAACCTCCACCCCCA

CCACCTCCGCCCTCCATGCCACAGCAGACTGCCCCAGCGATGAAGTCCTCGCCCCCACCCTTCATCACTGCCCAGGTCCCCGTCCTGGAACCACAGCTGC

CAGGCAGTGTCTTTGACCCTATTGGCCACTTCACCCAGCCCATCTTGCACCTGCCGCAGCCGGAGCTGCCTCCTCACCTGCCCCAGCCACCTGAGCACAG

CACTCCACCCCATCTCAACCAGCATGCTGTGGTCTCTCCTCCAG CTTTGCACAATGCGCTGCCCCAACAGCCATCTCGGCCCAGTAACCGAGCTGCTGC

TCTGCCCCCAAAGCCTACCCGACCCCCAGCTGTGTCCCCTGCCCTGGCCCAGCCCCCCCTGCTCCCACAACCACCAATGGCTCAGCCCCCCCAAGTGCTG

CTGGAGGATGAAGAGCCACCTGCCCCACCCCTCACCTCCATGCAGATGCAGTTGTACCTACAGCAGCTGCAGAAGGTGCAGCCTCCCACACCACTACTCC

CTTCCGTGAAGGTGCAGTCCCAACCCCCACCGCCTTTGCCGCCTCCACCCCACCCTTCTGTGCAGCAGCAGCAGCTCCAGCCACAGCCACCGCCACCCCC

ACCTCCTCAGCCACAGCCACCACCCCAGCAACAACACCAGCCTCCACCACGACCAGTTCACTTGCCATCCATGCCCTTTTCTGCTCATATTCAGCAGCCC

CCACCACCCCCAGGACAGCAACCTACTCACCCACCCCCAGGACAGCAGCCCCCACCACCACAGCCTGCCAAGCCCCAGCAAGTCATCCAGCATCACCCTT

CCCCCCGGCACCACAAGTCAGACCCCTACTCAGCTG GTCATCTTCGTGAGGCTCCCTCTCCGCTTATGATACATTCCCCTCAGATGCCACAGTTCCAGA

GCCTGACCCATCAGTCTCCTCCCCAGCAAAACGTCCAGCCTAAGAAGCAGGTAAAGGGCAGGGCTGAGCCACAGCCACCAGGGCCAGTCATGGGCCAAGG

CCAGGGATGCCCACCTGCCTCACCGGCTGCCGTGCCTATGCTGTCCCAGGAGCTGCGACCACCTTCAGTCGTCCAGCCCCAGCCCCTGGTGGTAGTAAAG

GAGGAGAAGATTCACTCACCAATCATTCGCAGCGAGCCTTTCAGCACCTCACTTCGACCAGAGCCCCCCAAGCACCCAGAGAACATCAAGGCCCCAGTCC

ACCTGCCCCAGC GGCCTGAGATGAAGCCTGTAGACATAGGGAGGCCTGTGATCCGGCCTCCAGAGCAGAGTGCACCCCCACCAGGGGCCCCTGACAAGG

ACAAACAGAAGCAGGAGCCAAAAACACCAGTGGCACCCAAAAAG - UNI2231 - GACCTGAAAATTAAGAACATGGGCTCCTGGGCCAGCCTGGTAC

AGAAGCATCCGACCACCCCATCCTCCACAGCCAAGTCCTCAAGTGACAGCTTTGAGCATTTCCGCCGTGCTGCTCGGGAGAAGGAGGAGAGGGAAAAGGC

CCTGAAGGCTCAGGCTGAGCATGCAGAGAAGGAGAAGGAGCGGCTGAGGCAGGAGCGCATGAG GAGCCGAGAGGATGAAGATGCGCTGGAACAGGCACG

TCGAGCCCATGAGGAGGCACGACGGCGCCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGAGACAGGAGCAGCAGCAGCAGCAGCAGCAGGCAGCTGCTGTG

GCCGCTGCCTCTGCCCCCCAGGCCCAGAGCTCCCAGCCCCAGTCTATGCTGGACCAGCAGAGGGAGTTGGCCCGGAAACGAGAGCAGGAGCGGAGGCGCA

GGGAGGCA - UNI2664 - ATGGCAGCTACAATTGACATGAATTTCCAGAGTGATCTTTTGTCAATATTTGAAGAAAATCTTTTTTGAGAGCACCCAG

GTGACTTCTGACTTTTTCTGGCAAAAATGTTGACTCTCCATCCATAGTGTTAGGGGCAGCCGTGGAAGCAGCAGCAGCCAGGGATGTCTCTGGGCCTGGC

TCTCCTGCATGCTGTGCCCGGGGCAGGCCTGACGGGCGGGCAGCTGAGGATCGCAGAGCCCATCTGCCTTACAGCCAGCCGGACAGACGTCCTACTACAT

GCCACCCCCTCAGAGGACGTCAGTTCAGGGCACGTCTCAATATGAGTCAAGTGCCAGCTGGACCTGAGGCCTGCTTCCCCGCGTGCGGGGCAGAGGCCCT

TCTCTGCGCCAAATGTCTGACTACACAGTATACACAGGACATTGTTGCTGCCGCCACCGAGACTGGTTTTCTGTCCCTGAGAACATGACGTTTGTGACGT

CCTACCCATTGGGAGTCCTTCACACCCCAGCCATCGCTGCCCACTCCCAGGAGGCCAGGGCAAGCCTGTGTGGACTGGAGCAGCAAGGCACTGGCCCACC

CCTTGCTGGCACTGACTTTGCCTTGAACAGACCCTCTCCCCTCCCCCACAAGCCTTTAATTGAGAGCCGCTCTTTATAAGTGTTCGCTTGTGCAAAAGGG

AATAGTGCCGTGGAAGTGTGTGTCCATGGCAGTTTGGACAGGGGTGACTGTTCACACGTATGGACAGGCCTCGCCTGGGGAGTAAGGCCACCAACCAAAG

TCAGTTCCTTCCCACCTGTGTTTCTGATTTTGTTTTGTTTTATTTTTTTCCTATATATATATTTTTTTTTGTTGTTGTTGAATTCTATTTTATTTTTAAC

TCTCTTCTCCTCAGACACAGTGGCACTGCTTATCTCCAAATGGTGTGATCGTCTCCTCAGTGAGCGGCGGCTCCCACTGCGCTGTGGGTAGTGTGTGACT

GTGGCTGTACTGTATAGTGAACATAGTTGGCATATCTTTGTTTGAAGTTTGTTGGTGATTCCACCAAACTGGTGTAAAAAACAAAAACAAAAAAACCCAC

AAACCACCCAAAACTCACAAAAAAAATCCTGCTTGTATTCAGTTTCAAACTTTATTAGTCTCACTTTTAATTATAAAACCAGAAAGCTGCAATTTCTTTT

CCCTCTACCCCTTATTTGTTGGCTTCTTTGTTTTTTTAATGTCAAATCTGTTTGTTTTTACCAAGAAAGGGAGAGCCTGAGGAGGTCTGCAGGCTTTGGT

GGGCTGCGAACCGAGGCGGAGGCCCCCACCCAGTACCTGGTGAGACCAGTGTGCTGCGCCTTCCTTCCTATTAGTATTTTTGTTTCGTTTTGTTTTTAAA

TTGGAGCCCCTGGTGAGGTTACATGTGCCATGAGAACCCACTCTACACCATAGTGCTGGTGCCTCAGTGTTGGCCAAACTCTGGAGTCACTGACTGGTTT

GACTTTCATGTGGTAAATATGCATTTGGTCTGTACTGATCATGGAATAAACACATCTCTCTTTTTTAA
Translation
 - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 -  - UNI5569 - - UNI23478 - - UNI29490 - MSTESGPGTR

LRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP - UNI13518 - -

 UNI23478 - - UNI29490 - DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK - UNI27535 - PGDDIVLMAEALEKL

FLQKINELPTEETEIMIVQAKGRGRGRKETG GAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPV

PPQPPPPPAPVPQPVQSHPPIIATTPQPVK TKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISE

QLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK SKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ - U

NI4057 - DVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQ LKAVHEQLAALSQPQQNKPK

KKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVS - UNI14985 - SKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDI

NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA - UNI14985 - AEKVDVIAGSSKMKGFSSSESESTS

ESSSSDSEDSETE - UNI6785 - - UNI14985 - EMAPKSKKKGHTGRDQKK HHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPP

PPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPA ALHNALPQQPSRPSNR

AAALPPKPTRPPAVSPALAQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQQLQPQPP

PPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAG GHLREAPSPLMIHSPQM

PQFQSLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENI

KAPVHLPQR RPEMKPVDIGRPVIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKK - UNI2231 - DLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFE

HFRRAAREKEEREKALKAQAEHAEKEKERLRQERMR RSREDEDALEQARRAHEEARRRQEQQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSML

DQQRELARKREQERRRREA - UNI2664 - MAATIDMNFQSDLLSIFEENLF
Transcript ENSMUST00000119123
Sequence
GACTGCCTCTGGATCTGCGGTGCGCGCCGGGCCGC - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 - CCAACAAGATAGCT

GTGTTCCAGTTTTGTTCAAAACTACTAGTGAAGAAGTCCTCCTCTCCTCTCATTCCCATATCTGCTTTCCGTCTGGACACAACATTGGGTCTAAGAAAAT

CAGCTCACCAGGCTGTGACCACTGAATCACATTGGAGTTCTCTGTAGTGAGTAAGAATTCTGGAATTAAAAAAAAACAGAAAAATTATGG - UNI2347

8 - - UNI29490 - AGTGCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTACGGAGAGCGGCCCTGGGACAAGATTGAGAAATCTGCCAGTAA

TGGGGGATGGACTAGAAACCTCCCAAATGTCTACAACGCAGGCCCAGGCCCAACCCCAGCCAGCAAATGCAGCCAGCACCAATCCTCCACCCCCAGAGAC

CTCCAACCCTAACAAGCCCAAGAGACAGACAAACCAACTGCAATATCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCGTGGCCTTTC

CAGCAGCCCGTGGATGCCGTCAAGCTGAACCTCCCT - UNI13518 - - UNI23478 - - UNI29490 - GATTACTATAAGATTATTAAAACA

CCCATGGATATGGGAACAATAAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTT

ACATCTATAACAAG - UNI27535 - CCTGGAGATGACATCGTCTTAATGGCAGAAGCTCTGGAGAAGCTCTTCTTGCAAAAAATCAATGAACTGCCT

ACAGAAGAAACTGAGATCATGATAGTCCAGGCAAAAGGAAGAGGACGAGGGAGGAAAGAAACAG GGGCAGCAAAGCCTGGTGTATCCACGGTACCAAAC

ACAACTCAAGCATCAACTTCTCCGCAGACCCAGACGCCTCAGCAGAACCCTCCTCCACCTGTGCAGGCCACAACTCACCCCTTTCCTGCTGTCACCCCAG

ACCTCATTGCCCAGCCTCCTGTCATGACAATGGTGCCCCCTCAGCCACTTCAGACTCCTTCACCGGTACCCCCCCAGCCACCACCCCCACCTGCTCCAGT

TCCACAGCCTGTGCAGAGTCACCCGCCCATCATTGCGACCACCCCCCAGCCTGTGAAG ACAAAGAAAGGGGTGAAGAGGAAAGCAGATACCACCACCCC

TACCACCATCGACCCCATTCATGAGCCACCCTCACTGGCCCCAGAGCCCAAGACCGCCAAGCTGGGTCCTCGGCGGGAGAGCAGCAGACCTGTGAAGCCT

CCAAAGAAGGATGTACCGGACTCACAGCAGCACCCAGGGCCAGAGAAGAGCAGCAAGATCTCTGAGCAGCTAAAGTGCTGCAGTGGCATCCTCAAGGAGA

TGTTTGCCAAGAAACATGCTGCCTATGCCTGGCCTTTCTACAAGCCTGTGGATGTGGAGGCACTGGGTCTGCACGACTACTGTGACATCATCAAACATCC

CATGGACATGAGCACAATCAAG TCTAAACTAGAGTCCCGAGAGTACAGAGATGCCCAGGAATTTGGTGCTGATGTCCGATTGATGTTCTCCAACTGCTA

CAAGTACAACCCCCCTGACCATGAAGTGGTAGCCATGGCTCGAAAACTCCAG - UNI4057 - GATGTGTTTGAAATGCGCTTTGCCAAGATGCCTGA

TGAGCCTGAAGAGCCAGTTGTTACAGTGTCCTCTCCTGCAGTGCCACCCCCTACAAAGGTGGTAGCCCCACCCTCATCTAGTGACAGCAGCAGCGACAGT

TCTTCCGACAGCGACAGTTCCACTGACGACTCTGAGGAAGAGCGAGCCCAGCGGCTGGCTGAACTCCAGGAACAG CTCAAGGCCGTGCATGAGCAGCTT

GCAGCCCTCTCACAGCCCCAGCAGAACAAACCAAAGAAAAAGGAGAAGGACAAGAAGGAAAAGAAAAAGGAAAAGCACAAAAAGAAAGAAGAAGTGGAGG

AAAATAAAAAAAGCAAAACCAAGGAACTTCCTCCCAAAAAGACAAAGAAAAATAACAGCAGCAACAGCAATGTGAG - UNI14985 - CAAGAAGGAA

CCAGTACCCACGAAGACCAAGCCGCCTCCCACATATGAATCAGAAGAGGAGGATAAGTGTAAGCCCATGTCTTATGAGGAGAAGCGGCAGCTAAGTCTAG

ATATCAACAAACTTCCTGGTGAGAAGCTAGGCCGTGTAGTACACATAATTCAGTCAAGGGAACCATCACTTAAAAACTCCAACCCCGATGAGATTGAGAT

TGACTTTGAGACCCTGAAGCCATCTACACTACGAGAGTTGGAGCGATATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG - UNI14985 - 

CTGAAAAAGTTGACGTGATTGCTGGTTCTTCCAAGATGAAGGGATTCTCATCCTCTGAGTCGGAGAGCACCAGCGAATCCAGCTCCTCTGACAGTGAAGA

CTCTGAAACAG - UNI6785 - - UNI14985 - AGATGGCTCCCAAGTCAAAAAAGAAGGGGCACACTGGGAGGGACCAGAAAAAG CATCATCAC

CATCACCATCCACAGATGCAGCCAGCCCCAGCTCCTGTGCCCCAGCAGCCGCCCCCACCTCCACAGCAGCCTCCTCCACCCCCACCTCCGCAGCAGCAGC

AGCAGCAACCTCCACCCCCACCACCTCCGCCCTCCATGCCACAGCAGACTGCCCCAGCGATGAAGTCCTCGCCCCCACCCTTCATCACTGCCCAGGTCCC

CGTCCTGGAACCACAGCTGCCAGGCAGTGTCTTTGACCCTATTGGCCACTTCACCCAGCCCATCTTGCACCTGCCGCAGCCGGAGCTGCCTCCTCACCTG

CCCCAGCCACCTGAGCACAGCACTCCACCCCATCTCAACCAGCATGCTGTGGTCTCTCCTCCAG CTTTGCACAATGCGCTGCCCCAACAGCCATCTCGG

CCCAGTAACCGAGCTGCTGCTCTGCCCCCAAAGCCTACCCGACCCCCAGCTGTGTCCCCTGCCCTGGCCCAGCCCCCCCTGCTCCCACAACCACCAATGG

CTCAGCCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCACCTGCCCCACCCCTCACCTCCATGCAGATGCAGTTGTACCTACAGCAGCTGCAGAAGGTGCA

GCCTCCCACACCACTACTCCCTTCCGTGAAGGTGCAGTCCCAACCCCCACCGCCTTTGCCGCCTCCACCCCACCCTTCTGTGCAGCAGCAGCAGCTCCAG

CCACAGCCACCGCCACCCCCACCTCCTCAGCCACAGCCACCACCCCAGCAACAACACCAGCCTCCACCACGACCAGTTCACTTGCCATCCATGCCCTTTT

CTGCTCATATTCAGCAGCCCCCACCACCCCCAGGACAGCAACCTACTCACCCACCCCCAGGACAGCAGCCCCCACCACCACAGCCTGCCAAGCCCCAGCA

AGTCATCCAGCATCACCCTTCCCCCCGGCACCACAAGTCAGACCCCTACTCAGCTG GTCATCTTCGTGAGGCTCCCTCTCCGCTTATGATACATTCCCC

TCAGATGCCACAGTTCCAGAGCCTGACCCATCAGTCTCCTCCCCAGCAAAACGTCCAGCCTAAGAAGCAGGTAAAGGGCAGGGCTGAGCCACAGCCACCA

GGGCCAGTCATGGGCCAAGGCCAGGGATGCCCACCTGCCTCACCGGCTGCCGTGCCTATGCTGTCCCAGGAGCTGCGACCACCTTCAGTCGTCCAGCCCC

AGCCCCTGGTGGTAGTAAAGGAGGAGAAGATTCACTCACCAATCATTCGCAGCGAGCCTTTCAGCACCTCACTTCGACCAGAGCCCCCCAAGCACCCAGA

GAACATCAAGGCCCCAGTCCACCTGCCCCAGC GGCCTGAGATGAAGCCTGTAGACATAGGGAGGCCTGTGATCCGGCCTCCAGAGCAGAGTGCACCCCC

ACCAGGGGCCCCTGACAAGGACAAACAGAAGCAGGAGCCAAAAACACCAGTGGCACCCAAAAAG - UNI2231 - GACCTGAAAATTAAGAACATGGG

CTCCTGGGCCAGCCTGGTACAGAAGCATCCGACCACCCCATCCTCCACAGCCAAGTCCTCAAGTGACAGCTTTGAGCATTTCCGCCGTGCTGCTCGGGAG

AAGGAGGAGAGGGAAAAGGCCCTGAAGGCTCAGGCTGAGCATGCAGAGAAGGAGAAGGAGCGGCTGAGGCAGGAGCGCATGAG GAGCCGAGAGGATGAA

GATGCGCTGGAACAGGCACGTCGAGCCCATGAGGAGGCACGACGGCGCCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGAGACAGGAGCAGCAGCAGCAGC

AGCAGCAGGCAGCTGCTGTGGCCGCTGCCTCTGCCCCCCAGGCCCAGAGCTCCCAGCCCCAGTCTATGCTGGACCAGCAGAGGGAGTTGGCCCGGAAACG

AGAGCAGGAGCGGAGGCGCAGGGAGGCA - UNI2664 - ATGGCAGCTACAATTGACATGAATTTCCAGAGTGATCTTTTGTCAATATTTGAAGAAAA

TCTTTTTTGAGAGCACCCAGGTGACTTCTGACTTTTTCTGGCAAAAATGTTGACTCTCCATCCATAGTGTTAGGGGCAGCCGTGGAAGCAGCAGCAGCCA

GGGATGTCTCTGGGCCTGGCTCTCCTGCATGCTGTGCCCGGGGCAGGCCTGACGGGCGGGCAGCTGAGGATCGCAGAGCCCATCTGCCTTACAGCCAGCC

GGACAGACGTCCTACTACATGCCACCCCCTCAGAGGACGTCAGTTCAGGGCACGTCTCAATATGAGTCAAGTGCCAGCTGGACCTGAGGCCTGCTTCCCC

GCGTGCGGGGCAGAGGCCCTTCTCTGCGCCAAATGTCTGACTACACAGTATACACAGGACATTGTTGCTGCCGCCACCGAGACTGGTTTTCTGTCCCTGA

GAACATGACGTTTGTGACGTCCTACCCATTGGGAGTCCTTCACACCCCAGCCATCGCTGCCCACTCCCAGGAGGCCAGGGCAAGCCTGTGTGGACTGGAG

CAGCAAGGCACTGGCCCACCCCTTGCTGGCACTGACTTTGCCTTGAACAGACCCTCTCCCCTCCCCCACAAGCCTTTAATTGAGAGCCGCTCTTTATAAG

TGTTCGCTTGTGCAAAAGGGAATAGTGCCGTGGAAGTGTGTGTCCATGGCAGTTTGGACAGGGGTGACTGTTCACACGTATGGACAGGCCTCGCCTGGGG

AGTAAGGCCACCAACCAAAGTCAGTTCCTTCCCACCTGTGTTTCTGATTTTGTTTTGTTTTATTTTTTTCCTATATATATATTTTTTTTTGTTGTTGTTG

AATTCTATTTTATTTTTAACTCTCTTCTCCTCAGACACAGTGGCACTGCTTATCTCCAAATGGTGTGATCGTCTCCTCAGTGAGCGGCGGCTCCCACTGC

GCTGTGGGTAGTGTGTGACTGTGGCTGTACTGTATAGTGAACATAGTTGGCATATCTTTGTTTGAAGTTTGTTGGTGATTCCACCAAACTGGTGTAAAAA

ACAAAAACAAAAAAACCCACAAACCACCCAAAACTCACAAAAAAAATCCTGCTTGTATTCAGTTTCAAACTTTATTAGTCTCACTTTTAATTATAAAACC

AGAAAGCTGCAATTTCTTTTCCCTCTACCCCTTATTTGTTGGCTTCTTTGTTTTTTTAATGTCAAATCTGTTTGTTTTTACCAAGAAAGGGAGAGCCTGA

GGAGGTCTGCAGGCTTTGGTGGGCTGCGAACCGAGGCGGAGGCCCCCACCCAGTACCTGGTGAGACCAGTGTGCTGCGCCTTCCTTCCTATTAGTATTTT

TGTTTCGTTTTGTTTTTAAATTGGAGCCCCTGGTGAGGTTACATGTGCCATGAGAACCCACTCTACACCATAGTGCTGGTGCCTCAGTGTTGGCCAAACT

CTGGAGTCACTGACTGGTTTGACTTTCATGTGGTAAATATGCATTTGGTCTGTACTGATCATGGAATAAACACATCTCTCTTTTTTAA
Translation
 - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 -  - UNI23478 - - UNI29490 - MSTESGPGTRLRNLPVMGDGLE

TSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP - UNI13518 - - UNI23478 - 

- UNI29490 - DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK - UNI27535 - PGDDIVLMAEALEKLFLQKINELPTEE

TEIMIVQAKGRGRGRKETG GAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPVPPQPPPPPAPVP

QPVQSHPPIIATTPQPVK TKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISEQLKCCSGILKEM

FAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK SKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ - UNI4057 - DVF

EMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQ LKAVHEQLAALSQPQQNKPKKKEKDKKEKKKE

KHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVS - UNI14985 - SKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVV

HIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA - UNI14985 - AEKVDVIAGSSKMKGFSSSESESTSESSSSDSEDSET

E - UNI6785 - - UNI14985 - EMAPKSKKKGHTGRDQKK HHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTA

PAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPA ALHNALPQQPSRPSNRAAALPPKPTRPP

AVSPALAQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQQLQPQPPPPPPPQPQPPPQ

QQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAG GHLREAPSPLMIHSPQMPQFQSLTHQSPP

QQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENIKAPVHLPQR RP

EMKPVDIGRPVIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKK - UNI2231 - DLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEHFRRAAREKEER

EKALKAQAEHAEKEKERLRQERMR RSREDEDALEQARRAHEEARRRQEQQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSMLDQQRELARKREQ

ERRRREA - UNI2664 - MAATIDMNFQSDLLSIFEENLF
Transcript ENSMUST00000003726
Sequence
GGAGGAGGAAGCGACTGCCTCTGGATCTGCGGTGCGCGCCGGGCCGC - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 - CC

AACAAGATAGCTGTGTTCCAGTTTTGTTCAAAACTACTAGTGAAGAAGTCCTCCTCTCCTCTCATTCCCATATCTGCTTTCCGTCTGGACACAACATTGG

GTCTAAGAAAATCAGCTCACCAGGCTGTGACCACTGAATCACATTGGAGTTCTCTGTA - UNI5569 - - UNI23478 - - UNI29490 - AGT

GCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTACGGAGAGCGGCCCTGGGACAAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACC

TCCCAAATGTCTACAACGCAGGCCCAGGCCCAACCCCAGCCAGCAAATGCAGCCAGCACCAATCCTCCACCCCCAGAGACCTCCAACCCTAACAAGCCCA

AGAGACAGACAAACCAACTGCAATATCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCGTGGCCTTTCCAGCAGCCCGTGGATGCCGT

CAAGCTGAACCTCCCT - UNI13518 - - UNI23478 - - UNI29490 - GATTACTATAAGATTATTAAAACACCCATGGATATGGGAACAAT

AAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTATAACAAG - UNI

27535 - CCTGGAGATGACATCGTCTTAATGGCAGAAGCTCTGGAGAAGCTCTTCTTGCAAAAAATCAATGAACTGCCTACAGAAGAAACTGAGATCAT

GATAGTCCAGGCAAAAGGAAGAGGACGAGGGAGGAAAGAAACAGGTA GGGCAGCAAAGCCTGGTGTATCCACGGTACCAAACACAACTCAAGCATCAAC

TTCTCCGCAGACCCAGACGCCTCAGCAGAACCCTCCTCCACCTGTGCAGGCCACAACTCACCCCTTTCCTGCTGTCACCCCAGACCTCATTGCCCAGCCT

CCTGTCATGACAATGGTGCCCCCTCAGCCACTTCAGACTCCTTCACCGGTACCCCCCCAGCCACCACCCCCACCTGCTCCAGTTCCACAGCCTGTGCAGA

GTCACCCGCCCATCATTGCGACCACCCCCCAGCCTGTGAAG ACAAAGAAAGGGGTGAAGAGGAAAGCAGATACCACCACCCCTACCACCATCGACCCCA

TTCATGAGCCACCCTCACTGGCCCCAGAGCCCAAGACCGCCAAGCTGGGTCCTCGGCGGGAGAGCAGCAGACCTGTGAAGCCTCCAAAGAAGGATGTACC

GGACTCACAGCAGCACCCAGGGCCAGAGAAGAGCAGCAAGATCTCTGAGCAGCTAAAGTGCTGCAGTGGCATCCTCAAGGAGATGTTTGCCAAGAAACAT

GCTGCCTATGCCTGGCCTTTCTACAAGCCTGTGGATGTGGAGGCACTGGGTCTGCACGACTACTGTGACATCATCAAACATCCCATGGACATGAGCACAA

TCAAG TCTAAACTAGAGTCCCGAGAGTACAGAGATGCCCAGGAATTTGGTGCTGATGTCCGATTGATGTTCTCCAACTGCTACAAGTACAACCCCCCTG

ACCATGAAGTGGTAGCCATGGCTCGAAAACTCCAG - UNI4057 - GATGTGTTTGAAATGCGCTTTGCCAAGATGCCTGATGAGCCTGAAGAGCCAG

TTGTTACAGTGTCCTCTCCTGCAGTGCCACCCCCTACAAAGGTGGTAGCCCCACCCTCATCTAGTGACAGCAGCAGCGACAGTTCTTCCGACAGCGACAG

TTCCACTGACGACTCTGAGGAAGAGCGAGCCCAGCGGCTGGCTGAACTCCAGGAACAG CTCAAGGCCGTGCATGAGCAGCTTGCAGCCCTCTCACAGCC

CCAGCAGAACAAACCAAAGAAAAAGGAGAAGGACAAGAAGGAAAAGAAAAAGGAAAAGCACAAAAAGAAAGAAGAAGTGGAGGAAAATAAAAAAAGCAAA

ACCAAGGAACTTCCTCCCAAAAAGACAAAGAAAAATAACAGCAGCAACAGCAATGTGAG - UNI14985 - CAAGAAGGAACCAGTACCCACGAAGAC

CAAGCCGCCTCCCACATATGAATCAGAAGAGGAGGATAAGTGTAAGCCCATGTCTTATGAGGAGAAGCGGCAGCTAAGTCTAGATATCAACAAACTTCCT

GGTGAGAAGCTAGGCCGTGTAGTACACATAATTCAGTCAAGGGAACCATCACTTAAAAACTCCAACCCCGATGAGATTGAGATTGACTTTGAGACCCTGA

AGCCATCTACACTACGAGAGTTGGAGCGATATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG - UNI14985 - CTGAAAAAGTTGACGTG

ATTGCTGGTTCTTCCAAGATGAAGGGATTCTCATCCTCTGAGTCGGAGAGCACCAGCGAATCCAGCTCCTCTGACAGTGAAGACTCTGAAACAG - UNI

6785 - - UNI14985 - AGATGGCTCCCAAGTCAAAAAAGAAGGGGCACACTGGGAGGGACCAGAAAAAG CATCATCACCATCACCATCCACAGAT

GCAGCCAGCCCCAGCTCCTGTGCCCCAGCAGCCGCCCCCACCTCCACAGCAGCCTCCTCCACCCCCACCTCCGCAGCAGCAGCAGCAGCAACCTCCACCC

CCACCACCTCCGCCCTCCATGCCACAGCAGACTGCCCCAGCGATGAAGTCCTCGCCCCCACCCTTCATCACTGCCCAGGTCCCCGTCCTGGAACCACAGC

TGCCAGGCAGTGTCTTTGACCCTATTGGCCACTTCACCCAGCCCATCTTGCACCTGCCGCAGCCGGAGCTGCCTCCTCACCTGCCCCAGCCACCTGAGCA

CAGCACTCCACCCCATCTCAACCAGCATGCTGTGGTCTCTCCTCCAG CTTTGCACAATGCGCTGCCCCAACAGCCATCTCGGCCCAGTAACCGAGCTGC

TGCTCTGCCCCCAAAGCCTACCCGACCCCCAGCTGTGTCCCCTGCCCTGGCCCAGCCCCCCCTGCTCCCACAACCACCAATGGCTCAGCCCCCCCAAGTG

CTGCTGGAGGATGAAGAGCCACCTGCCCCACCCCTCACCTCCATGCAGATGCAGTTGTACCTACAGCAGCTGCAGAAGGTGCAGCCTCCCACACCACTAC

TCCCTTCCGTGAAGGTGCAGTCCCAACCCCCACCGCCTTTGCCGCCTCCACCCCACCCTTCTGTGCAGCAGCAGCAGCTCCAGCCACAGCCACCGCCACC

CCCACCTCCTCAGCCACAGCCACCACCCCAGCAACAACACCAGCCTCCACCACGACCAGTTCACTTGCCATCCATGCCCTTTTCTGCTCATATTCAGCAG

CCCCCACCACCCCCAGGACAGCAACCTACTCACCCACCCCCAGGACAGCAGCCCCCACCACCACAGCCTGCCAAGCCCCAGCAAGTCATCCAGCATCACC

CTTCCCCCCGGCACCACAAGTCAGACCCCTACTCAGCTG GTCATCTTCGTGAGGCTCCCTCTCCGCTTATGATACATTCCCCTCAGATGCCACAGTTCC

AGAGCCTGACCCATCAGTCTCCTCCCCAGCAAAACGTCCAGCCTAAGAAGCAGGTAAAGGGCAGGGCTGAGCCACAGCCACCAGGGCCAGTCATGGGCCA

AGGCCAGGGATGCCCACCTGCCTCACCGGCTGCCGTGCCTATGCTGTCCCAGGAGCTGCGACCACCTTCAGTCGTCCAGCCCCAGCCCCTGGTGGTAGTA

AAGGAGGAGAAGATTCACTCACCAATCATTCGCAGCGAGCCTTTCAGCACCTCACTTCGACCAGAGCCCCCCAAGCACCCAGAGAACATCAAGGCCCCAG

TCCACCTGCCCCAGC GGCCTGAGATGAAGCCTGTAGACATAGGGAGGCCTGTGATCCGGCCTCCAGAGCAGAGTGCACCCCCACCAGGGGCCCCTGACA

AGGACAAACAGAAGCAGGAGCCAAAAACACCAGTGGCACCCAAAAAG - UNI2231 - GACCTGAAAATTAAGAACATGGGCTCCTGGGCCAGCCTGG

TACAGAAGCATCCGACCACCCCATCCTCCACAGCCAAGTCCTCAAGTGACAGCTTTGAGCATTTCCGCCGTGCTGCTCGGGAGAAGGAGGAGAGGGAAAA

GGCCCTGAAGGCTCAGGCTGAGCATGCAGAGAAGGAGAAGGAGCGGCTGAGGCAGGAGCGCATGAG GAGCCGAGAGGATGAAGATGCGCTGGAACAGGC

ACGTCGAGCCCATGAGGAGGCACGACGGCGCCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGAGACAGGAGCAGCAGCAGCAGCAGCAGCAGGCAGCTGCT

GTGGCCGCTGCCTCTGCCCCCCAGGCCCAGAGCTCCCAGCCCCAGTCTATGCTGGACCAGCAGAGGGAGTTGGCCCGGAAACGAGAGCAGGAGCGGAGGC

GCAGGGAGGCA - UNI2664 - ATGGCAGCTACAATTGACATGAATTTCCAGAGTGATCTTTTGTCAATATTTGAAGAAAATCTTTTTTGAGAGCACC

CAGGTGACTTCTGACTTTTTCTGGCAAAAATGTTGACTCTCCATCCATAGTGTTAGGGGCAGCCGTGGAAGCAGCAGCAGCCAGGGATGTCTCTGGGCCT

GGCTCTCCTGCATGCTGTGCCCGGGGCAGGCCTGACGGGCGGGCAGCTGAGGATCGCAGAGCCCATCTGCCTTACAGCCAGCCGGACAGACGTCCTACTA

CATGCCACCCCCTCAGAGGACGTCAGTTCAGGGCACGTCTCAATATGAGTCAAGTGCCAGCTGGACCTGAGGCCTGCTTCCCCGCGTGCGGGGCAGAGGC

CCTTCTCTGCGCCAAATGTCTGACTACACAGTATACACAGGACATTGTTGCTGCCGCCACCGAGACTGGTTTTCTGTCCCTGAGAACATGACGTTTGTGA

CGTCCTACCCATTGGGAGTCCTTCACACCCCAGCCATCGCTGCCCACTCCCAGGAGGCCAGGGCAAGCCTGTGTGGACTGGAGCAGCAAGGCACTGGCCC

ACCCCTTGCTGGCACTGACTTTGCCTTGAACAGACCCTCTCCCCTCCCCCACAAGCCTTTAATTGAGAGCCGCTCTTTATAAGTGTTCGCTTGTGCAAAA

GGGAATAGTGCCGTGGAAGTGTGTGTCCATGGCAGTTTGGACAGGGGTGACTGTTCACACGTATGGACAGGCCTCGCCTGGGGAGTAAGGCCACCAACCA

AAGTCAGTTCCTTCCCACCTGTGTTTCTGATTTTGTTTTGTTTTATTTTTTTCCTATATATATATTTTTTTTTGTTGTTGTTGAATTCTATTTTATTTTT

AACTCTCTTCTCCTCAGACACAGTGGCACTGCTTATCTCCAAATGGTGTGATCGTCTCCTCAGTGAGCGGCGGCTCCCACTGCGCTGTGGGTAGTGTGTG

ACTGTGGCTGTACTGTATAGTGAACATAGTTGGCATATCTTTGTTTGAAGTTTGTTGGTGATTCCACCAAACTGGTGTAAAAAACAAAAACAAAAAAACC

CACAAACCACCCAAAACTCACAAAAAAAATCCTGCTTGTATTCAGTTTCAAACTTTATTAGTCTCACTTTTAATTATAAAACCAGAAAGCTGCAATTTCT

TTTCCCTCTACCCCTTATTTGTTGGCTTCTTTGTTTTTTTAATGTCAAATCTGTTTGTTTTTACCAAGAAAGGGAGAGCCTGAGGAGGTCTGCAGGCTTT

GGTGGGCTGCGAACCGAGGCGGAGGCCCCCACCCAGTACCTGGTGAGACCAGTGTGCTGCGCCTTCCTTCCTATTAGTATTTTTGTTTCGTTTTGTTTTT

AAATTGGAGCCCCTGGTGAGGTTACATGTGCCATGAGAACCCACTCTACACCATAGTGCTGGTGCCTCAGTGTTGGCCAAACTCTGGAGTCACTGACTGG

TTTGACTTTCATGTGGTAAATATGCATTTGGTCTGTACTGATCATGGAATAAACACATCTCTCTTTTTT
Translation
 - UNI5569 - - UNI8959 - - UNI16468 - - UNI29490 -  - UNI5569 - - UNI23478 - - UNI29490 - MSTESGPGTR

LRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP - UNI13518 - -

 UNI23478 - - UNI29490 - DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK - UNI27535 - PGDDIVLMAEALEKL

FLQKINELPTEETEIMIVQAKGRGRGRKETGR RAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSP

VPPQPPPPPAPVPQPVQSHPPIIATTPQPVK TKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKIS

EQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIK SKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ - 

UNI4057 - DVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQ LKAVHEQLAALSQPQQNKP

KKKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVS - UNI14985 - SKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLD

INKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA - UNI14985 - AEKVDVIAGSSKMKGFSSSESEST

SESSSSDSEDSETE - UNI6785 - - UNI14985 - EMAPKSKKKGHTGRDQKK HHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPP

PPPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPA ALHNALPQQPSRPSN

RAAALPPKPTRPPAVSPALAQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQQLQPQP

PPPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAG GHLREAPSPLMIHSPQ

MPQFQSLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPEN

IKAPVHLPQR RPEMKPVDIGRPVIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKK - UNI2231 - DLKIKNMGSWASLVQKHPTTPSSTAKSSSDSF

EHFRRAAREKEEREKALKAQAEHAEKEKERLRQERMR RSREDEDALEQARRAHEEARRRQEQQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSM

LDQQRELARKREQERRRREA - UNI2664 - MAATIDMNFQSDLLSIFEENLF

For any suggestions or comments, please send an email to unitrap@crg.es