Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024006 (Stk38)
Chromosomal location
Chr 17: 29107830 - 29144882 (-)
Description
serine/threonine kinase 38 Gene [Source:MGI (curated);Acc:Stk38-001]
RefSeq_dna
NM_134115 
RefSeq_peptide
NP_598876.1 
UniGene
Mm.439986 
MGI
MGI:2442572 
Uniprot/SWISSPROT
Q91VJ4 
Uniprot/SPTREMBL
Q8BJ33 Q8BJS2 B2KF04 
Human Ortholog
ENSG00000112079 (STK38)
Omim not available
UniTrap UNI11537
Vector Insertion
Chr 17: 29137090 - 29144655
Public Clones (sanger) E041B09 (ggtc) D031C07 (ggtc) P143D07 (ggtc) D137A04 (ggtc)
D007B01 (ggtc) W198E05 (ggtc) P127D04 (ggtc) D043E12 (ggtc) D143D01 (ggtc)
D027G04 (ggtc) P023D02 (ggtc) P135G06 (ggtc) D119G02 (ggtc) P094A04 (ggtc)
D036H08 (ggtc) D027A07 (ggtc) W197E05 (ggtc) PST8725-NR (escells) PST8184-NR (escells)
PSTVU01.HE35R (vanderbilt) PSTVU01.E456 (vanderbilt) IST10228H4 (tigm)
IST14557E9 (tigm) IST14567A8 (tigm) IST14579D2 (tigm) IST14183D2 (tigm)
IST10551C3 (tigm) IST14508A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16409
Vector Insertion
Chr 17: 29136953 - 29137087
Public Clones not available
Private Clones OST461630 (lexicon) OST453487 (lexicon) OST443649 (lexicon) OST415703 (lexicon)
OST199793 (lexicon) OST185574 (lexicon) OST150854 (lexicon) OST129007 (lexicon)
OST59697 (lexicon) OST38362 (lexicon) OST37513 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19402
Vector Insertion
Chr 17: 29129414 - 29136953
Public Clones IST14724A5 (tigm)
Private Clones OST391983 (lexicon) OST380827 (lexicon) OST232552 (lexicon) OST230710 (lexicon)
OST219223 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19647
Vector Insertion
Chr 17: 29128366 - 29129361
Public Clones not available
Private Clones OST385117 (lexicon) OST225419 (lexicon) OST172109 (lexicon) OST155732 (lexicon)
OST134984 (lexicon) OST131210 (lexicon) OST100254 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36891
Vector Insertion
Chr 17: 29125122 - 29128366
Public Clones 3SE223D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30158
Vector Insertion
Chr 17: 29121021 - 29125207
Public Clones D098B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31948
Vector Insertion
Chr 17: 29118976 - 29121146
Public Clones CMHD-GT_420E2-3 (cmhd) (cmhd) IST12073H1 (tigm) IST10815F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30683
Vector Insertion
Chr 17: 29117329 - 29119132
Public Clones IST10480B5 (tigm) IST14579G7 (tigm) IST11426C11BBF1 (tigm) IST11027H12 (tigm)
IST12124D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4991
Vector Insertion
Chr 17: 29109622 - 29109989
Public Clones YTC377 (baygenomics) A055C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069459
Sequence
CGGCCCCTCTCCACAGTCTGAGGGGGTACCGGGGGAGCCTTGGCCCCTCCGCGCCGCCGTCTTTTCCGGCAGTTGGGGTTCTTCCTTTTGTCCTGTCCTG

TCGCGGATCGGCAGCTGCGCTCATTCGGAGTCCCCGGCGTGTCGCGGTCGCTCTGGAGCCGCCCGCACGTCGCGTCTGCGCCGTCTCTGTAGCCGTCGGC

CCCGCGCCTCCCTCCCCCCTGGGTCTG - UNI11537 - - UNI16409 - CCATGGCAATGACAGGATCAACACCTTGCTCATCCATGAGTAATCA

TACGAAGGAGAGGGTGACAATGACCAAAGTGACACTGGAGAATTTTTATAGCAACCTTATCGCTCAACATGAAGAACGAGAAATGAG - UNI16409 -

 - UNI19402 - ACAAAAGAAGTTAGAAAAGGTGATGGAAGAAGAAGGCCTGAAAGACGAAGAG - UNI19647 - AAACGACTCAGAAGATCCGC

GCACGCTCGGAAGGAAACAGAGTTTCTTCGATTAAAGAGAACAAGGCTTGGACTGGAAGATTTTGAGTCTTTAAAAGTCATAGGCCGAGGAGCATTTGGT

GAG - UNI30158 - GTGCGGCTTGTTCAGAAGAAAGACACAGGGCATGTGTACGCAATGAAAATCCTGCGCAAAGCAGACATGCTCGAGAAGGAGCA

G - UNI30158 - - UNI31948 - GTTGGCCACATTCGTGCGGAGCGTGACATTCTAGTGGAGGCAGACAGTTTGTGGGTTGTGAAAATGTTCTAT

AGTTTTCAGGATAAGCTAAACCTCTACCTAATCATGGAGTTCCTGCCTGGAG - UNI30158 - - UNI30683 - - UNI31948 - GGGACATG

ATGACTTTATTGATGAAAAAAGATACTCTGACAGAAGAGGAGACTCAGTTTTATATAGCAGAGACAGTATTAGCCATAGACTCCATTCACCAGCTGGGAT

TCATCCACAGAGATATCAAGCCAGACAACCTTCTCTTGGACAGCAAG - UNI30683 - - UNI31948 - GTGTCTTTGGAAGGCCCAGGATTCTT

GTCTTTCTGTGGAAACTTTACTTGCTGTGCCATGAGGGCAGGAGGCTGGTCAGATAATATTTTGTGTCAGCAGTTCTGTTCTGTAAGGATGCATATAAAG

AGCCAGGCATGA
Translation
 - UNI11537 - - UNI16409 - MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMR - UNI16409 - - UNI19402 - RQ

KKLEKVMEEEGLKDEE - UNI19647 - KRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGE - UNI30158 - VRLVQKKDTGHVYAM

KILRKADMLEKEQ - UNI30158 - - UNI31948 - VGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGG - UNI30158 - - UN

I30683 - - UNI31948 - GDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSK - UNI30683 - - UNI31948 -

 VSLEGPGFLSFCGNFTCCAMRAGGWSDNILCQQFCSVRMHIKSQA
Transcript ENSMUST00000119274
Sequence
CGGCCCCTCTCCACAGTCTGAGGGGGTACCGGGGGAGCCTTGGCCCCTCCGCGCCGCCGTCTTTTCCGGCAGTTGGGGTTCTTCCTTTTGTCCTGTCCTG

TCGCGGATCGGCAGCTGCGCTCATTCGGAGTCCCCGGCGTGTCGCGGTCGCTCTGGAGCCGCCCGCACGTCGCGTCTGCGCCGTCTCTGTAGCCGTCGGC

CCCGCGCCTCCCTCCCCCCTGGGTCTG - UNI11537 - CAGCCATGGCAATGACAGGATCAACACCTTGCTCATCCATGAGTAATCATACGAAGGAG

AGGGTGACAATGACCAAAGTGACACTGGAGAATTTTTATAGCAACCTTATCGCTCAACATGAAGAACGAGAAATGAG - UNI16409 - - UNI1940

2 - ACAAAAGAAGTTAGAAAAGGTGATGGAAGAAGAAGGCCTGAAAGACGAAGAG - UNI19647 - AAACGACTCAGAAGATCCGCGCACGCTCGG

AAGGAAACAGAGTTTCTTCGATTAAAGAGAACAAGGCTTGGACTGGAAGATTTTGAGTCTTTAAAAGTCATAGGCCGAGGAGCATTTGGTGAG - UNI3

0158 - GTGCGGCTTGTTCAGAAGAAAGACACAGGGCATGTGTACGCAATGAAAATCCTGCGCAAAGCAGACATGCTCGAGAAGGAGCAG - UNI301

58 - - UNI31948 - GTTGGCCACATTCGTGCGGAGCGTGACATTCTAGTGGAGGCAGACAGTTTGTGGGTTGTGAAAATGTTCTATAGTTTTCAGG

ATAAGCTAAACCTCTACCTAATCATGGAGTTCCTGCCTGGAG - UNI30158 - - UNI30683 - - UNI31948 - GGGACATGATGACTTTAT

TGATGAAAAAAGATACTCTGACAGAAGAGGAGACTCAGTTTTATATAGCAGAGACAGTATTAGCCATAGACTCCATTCACCAGCTGGGATTCATCCACAG

AGATATCAAGCCAGACAACCTTCTCTTGGACAGCAAG - UNI30683 - - UNI31948 - GGCCATGTGAAACTTTCCGACTTTGGCCTTTGCACA

GGCCTGAAAAAAGCACACAGGACAGAATTTTATAGGAACCTGAACCACAGCCTGCCCAGTGATTTCA CTTTTCAGAACATGAATTCCAAAAGGAAAGCA

GAGACCTGGAAAAGAAACAGACGCCAGCTA GCCTTCTCTACAGTGGGCACTCCTGACTACATTGCTCCAGAGGTGTTCATGCAGACGGGTTACAACAAG

CTCTGCGATTGGTGGTCGCTCGGGGTAATCATGTATGAGATGCTCATCG GCTACCCACCATTCTGCTCCGAGACCCCACAAGAGACATACAAGAAAGTG

ATGAACTGGAAGGAAACTTTGACCTTTCCTCCAGAAGTTCCTGTCTCCGAGAAAGCCAAGGGCCTGATTCTGAG GTTCTGCTGTGAATGGGAACATAGA

ATCGGAGCCCCTGGAGTTGAAGAAATAAAAAATAATCTTTTTTTTGAAGGTGTTGACTGGGAACACATCAG GGAGAGACCAGCTGCGATATCTATTGAA

ATCAAGAGCATCGATGATACCTCAAACTTCGATGAATTTCCAGAGTCTGATATTCTTAAGCCCACAG - UNI4991 - TGACCACAAGTAGTCATCCT

GAGACGGACTACAAGAACAAAGACTGGGTCTTCATCAATTACACATACAAGCGCTTCGAGGGCCTGACAGCCAGGGGGGCCATACCTTCGTACATGAAAG

CAGCAAAATAGGGCCTGTGCTGGGAACCCTAAATGGGGCAGTGGTCTCTATACAACATTGTGGTTTTCCTCTTGCGCTCTTGAAAGAACTTCCAAGAAGT

TTGTAGAATTCATTAATACATCCTAGTCAAGTCTCTGAAATGTGATTGTAAGTGGATATTCCTCCACGGTGCACCGGGAAGCTGATAGGACAGAGACAAG

CATTTTTCCATCGGCCATAAGCAGCTGCTTGCTTCTTTTGAAGCCCCATGAGCCAGTTTGGTATGTGCTGTAAAGAGAATTTGATTTCCCCAAGTTGATC

AGAATGAAGGGGAAAAGCAG
Translation
 - UNI11537 - MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMR - UNI16409 - - UNI19402 - RQKKLEKVMEEEGLK

DEE - UNI19647 - KRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGE - UNI30158 - VRLVQKKDTGHVYAMKILRKADMLEKEQ

 - UNI30158 - - UNI31948 - VGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGG - UNI30158 - - UNI30683 - - UN

I31948 - GDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSK - UNI30683 - - UNI31948 - GHVKLSDFGLCT

GLKKAHRTEFYRNLNHSLPSDFT TFQNMNSKRKAETWKRNRRQL AFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIG GYPPFCSETPQET

YKKVMNWKETLTFPPEVPVSEKAKGLILR RFCCEWEHRIGAPGVEEIKNNLFFEGVDWEHIR RERPAAISIEIKSIDDTSNFDEFPESDILKPTV - 

UNI4991 - VTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Transcript ENSMUST00000009138
Sequence
CGGCCCCTCTCCACAGTCTGAGGGGGTACCGGGGGAGCCTTGGCCCCTCCGCGCCGCCGTCTTTTCCGGCAGTTGGGGTTCTTCCTTTTGTCCTGTCCTG

TCGCGGATCGGCAGCTGCGCTCATTCGGAGTCCCCGGCGTGTCGCGGTCGCTCTGGAGCCGCCCGCACGTCGCGTCTGCGCCGTCTCTGTAGCCGTCGGC

CCCGCGCCTCCCTCCCCCCTGGGTCTG - UNI11537 - - UNI16409 - CCATGGCAATGACAGGATCAACACCTTGCTCATCCATGAGTAATCA

TACGAAGGAGAGGGTGACAATGACCAAAGTGACACTGGAGAATTTTTATAGCAACCTTATCGCTCAACATGAAGAACGAGAAATGAG - UNI16409 -

 - UNI19402 - ACAAAAGAAGTTAGAAAAGGTGATGGAAGAAGAAGGCCTGAAAGACGAAGAG - UNI19647 - AAACGACTCAGAAGATCCGC

GCACGCTCGGAAGGAAACAGAGTTTCTTCGATTAAAGAGAACAAGGCTTGGACTGGAAGATTTTGAGTCTTTAAAAGTCATAGGCCGAGGAGCATTTGGT

GAG - UNI30158 - GTGCGGCTTGTTCAGAAGAAAGACACAGGGCATGTGTACGCAATGAAAATCCTGCGCAAAGCAGACATGCTCGAGAAGGAGCA

G - UNI30158 - - UNI31948 - GTTGGCCACATTCGTGCGGAGCGTGACATTCTAGTGGAGGCAGACAGTTTGTGGGTTGTGAAAATGTTCTAT

AGTTTTCAGGATAAGCTAAACCTCTACCTAATCATGGAGTTCCTGCCTGGAG - UNI30158 - - UNI30683 - - UNI31948 - GGGACATG

ATGACTTTATTGATGAAAAAAGATACTCTGACAGAAGAGGAGACTCAGTTTTATATAGCAGAGACAGTATTAGCCATAGACTCCATTCACCAGCTGGGAT

TCATCCACAGAGATATCAAGCCAGACAACCTTCTCTTGGACAGCAAG - UNI30683 - - UNI31948 - GGCCATGTGAAACTTTCCGACTTTGG

CCTTTGCACAGGCCTGAAAAAAGCACACAGGACAGAATTTTATAGGAACCTGAACCACAGCCTGCCCAGTGATTTCA CTTTTCAGAACATGAATTCCAA

AAGGAAAGCAGAGACCTGGAAAAGAAACAGACGCCAGCTA GCCTTCTCTACAGTGGGCACTCCTGACTACATTGCTCCAGAGGTGTTCATGCAGACGGG

TTACAACAAGCTCTGCGATTGGTGGTCGCTCGGGGTAATCATGTATGAGATGCTCATCG GCTACCCACCATTCTGCTCCGAGACCCCACAAGAGACATA

CAAGAAAGTGATGAACTGGAAGGAAACTTTGACCTTTCCTCCAGAAGTTCCTGTCTCCGAGAAAGCCAAGGGCCTGATTCTGAG GTTCTGCTGTGAATG

GGAACATAGAATCGGAGCCCCTGGAGTTGAAGAAATAAAAAATAATCTTTTTTTTGAAGGTGTTGACTGGGAACACATCAG GGAGAGACCAGCTGCGAT

ATCTATTGAAATCAAGAGCATCGATGATACCTCAAACTTCGATGAATTTCCAGAGTCTGATATTCTTAAGCCCACAG - UNI4991 - TGACCACAAG

TAGTCATCCTGAGACGGACTACAAGAACAAAGACTGGGTCTTCATCAATTACACATACAAGCGCTTCGAGGGCCTGACAGCCAGGGGGGCCATACCTTCG

TACATGAAAGCAGCAAAATAGGGCCTGTGCTGGGAACCCTAAATGGGGCAGTGGTCTCTATACAACATTGTGGTTTTCCTCTTGCGCTCTTGAAAGAACT

TCCAAGAAGTTTGTAGAATTCATTAATACATCCTAGTCAAGTCTCTGAAATGTGATTGTAAGTGGATATTCCTCCACGGTGCACCGGGAAGCTGATAGGA

CAGAGACAAGCATTTTTCCATCGGCCATAAGCAGCTGCTTGCTTCTTTTGAAGCCCCATGAGCCAGTTTGGTATGTGCTGTAAAGAGAATTTGATTTCCC

CAAGTTGATCAGAATGAAGGGGAAAAGCAGCTGCCCACTGTTACTGAACTGTTACACACTGAGTACCAGCCAACGCCCTGTGCTGTGGTGATGATATGCC

ACCTGCCAAGCCCACCAAGTATTTTTCTCCTTATAGCTGAAAATTCTGTAGTTAAATAAGGCAATAATGAAAGTCTGTGTGAACAGCCAACAGTGTGGCA

GAAGGAACAATCTCGGTCTCGCAGGTGCCGGTGGTTTCTCCCCATACCTTGGCCCTCACAAGTGGCTTTCCACAGCCTTCACTCATGGTGCACTTTACTT

ATGGTACTAGGACAAAGACCCTGATCTACTGACCTGTCTCCCATCCAAAAGACTCATGCTGCTCTTCTGTTGATGGGAGAGGTACTAGTGTGATCCTTTT

TGATCTTAGAAAGCCCATAAAGGCACTGGGCACTGCCAAGGAGTTCTGGACCCTGTGGACAACCCTTACTTTCCCTTCACGGCTGTAGATCATCTTGAGG

CACACACTGCCTACCAGCAAGCAATACCTGCAAGTGCTGCCATGCAAGTGCCCACAGCCTCCTTGGGAGTCAAGGCAGGACCAGCCCGCTGGGTCCTTGA

GCTCATTCCTCAATCCATGGTGCAACCGTGTTTGTCTTGATATTTCCTTACCCCAACTTTAGCCATTTTGCCTTGGAATCATGATTACAAAATTTTCCTT

TGCAGATGCCTTCTTGGGGGCATTCTTGTCCCTCCACCCAAAAGGGTTGCCTGCAGCTTGGGCTGATACGCCTCTGCTGTGGCGTTCTCTCATGAGAAAC

ACTGAATTTAGCACAAAGTGCCTTCTCTGTCATGGCTGCTGCCACCTTTAGAAGATTTTTCGCTGTGTCAGAAAAATGTGGAGGTTCCATATAATGACTT

TGGTTTTAAGTGTTGATAACTGTTAAGGCATTATTTGCACCTGTGTGGTAACTTGCAGTCATTGGCCAAGCTACAACTGGGATCGGCCCTCCGCTGGTCC

CGAAGTTTGTGAAGTCAGCTCAGTCTTAGCTCAGCCATTCAGAGGATAGAATTTAAGACTTATAAGCAGAACTGCTTTGGGTTTTCATGTCTTAGATGAA

GAAAAAGGAATGTTAGGGAAGTCTTAACTCTGGGTTAAGATGTTAGCTCCTTAATCCTCTATTCAGAGCCTGCTAATGCAAAGGAGATAGAAGGGCCTGG

GCGTGGCTTTGTGTTCTATTGATAAAACAGTTGAGGCTCGATCCCCGTGTGTTTGCAGGAGTGTGTGGTGAGCATGGGAGAATAAGAATAGTGGTAGAGT

CTGTGTGGTGGGGATGATTCATTTGGGGGGAAATGTTCACATTTTAACTATTCAACTTTTGAATAAACTGTGAAAACGATAA
Translation
 - UNI11537 - - UNI16409 - MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMR - UNI16409 - - UNI19402 - RQ

KKLEKVMEEEGLKDEE - UNI19647 - KRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGE - UNI30158 - VRLVQKKDTGHVYAM

KILRKADMLEKEQ - UNI30158 - - UNI31948 - VGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGG - UNI30158 - - UN

I30683 - - UNI31948 - GDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSK - UNI30683 - - UNI31948 -

 GHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFT TFQNMNSKRKAETWKRNRRQL AFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIG 

GYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILR RFCCEWEHRIGAPGVEEIKNNLFFEGVDWEHIR RERPAAISIEIKSIDDTSNFDEF

PESDILKPTV - UNI4991 - VTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK

For any suggestions or comments, please send an email to unitrap@crg.es