Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024008 (Cpne5)
Chromosomal location
Chr 17: 29293497 - 29374742 (-)
Description
copine V Gene [Source:MGI (curated);Acc:Cpne5-001]
RefSeq_dna
NM_153166 
RefSeq_peptide
NP_694806.1 
MGI
MGI:2385908 
Uniprot/SWISSPROT
Q8JZW4 
Uniprot/SPTREMBL
Q8BVA1 B2KF44 
Human Ortholog
ENSG00000124772 (CPNE5)
Omim not available
UniTrap UNI29191
Vector Insertion
Chr 17: 29348697 - 29362135
Public Clones IST12132F2 (tigm) IST14923E3 (tigm) IST11110D7 (tigm)
Private Clones OST6282 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23593
Vector Insertion
Chr 17: 29346446 - 29346634
Public Clones not available
Private Clones OST252314 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15875
Vector Insertion
Chr 17: 29325237 - 29325342
Public Clones not available
Private Clones OST471191 (lexicon) OST464825 (lexicon) OST442542 (lexicon) OST434943 (lexicon)
OST433683 (lexicon) OST418059 (lexicon) OST412410 (lexicon) OST399813 (lexicon)
OST393911 (lexicon) OST391883 (lexicon) OST376436 (lexicon) OST308981 (lexicon)
OST302753 (lexicon) OST293668 (lexicon) OST285093 (lexicon) OST249187 (lexicon)
OST165182 (lexicon) OST111831 (lexicon) OST92921 (lexicon) OST19861 (lexicon)
OST19805 (lexicon) OST13535 (lexicon) OST1580 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33308
Vector Insertion
Chr 17: 29325237 - 29339514
Public Clones IST12668G1 (tigm) IST13971C9 (tigm) IST10989G11 (tigm) IST13945H9 (tigm)
IST14913E6 (tigm) IST14587F2 (tigm) IST13977D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22186
Vector Insertion
Chr 17: 29320973 - 29325237
Public Clones not available
Private Clones OST303951 (lexicon) OST297286 (lexicon) OST118725 (lexicon) OST99157 (lexicon)
OST2718 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13009
Vector Insertion
Chr 17: 29320867 - 29320973
Public Clones CMHD-GT_354C5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18906
Vector Insertion
Chr 17: 29313149 - 29320867
Public Clones not available
Private Clones OST411615 (lexicon) OST411284 (lexicon) OST197865 (lexicon) OST174199 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20067
Vector Insertion
Chr 17: 29310346 - 29313106
Public Clones not available
Private Clones OST374002 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37283
Vector Insertion
Chr 17: 29299317 - 29299380
Public Clones CMHD-GT_462B8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057091
Sequence
CGCCCAGCCCAGGGCTGCAGCCGCTCCGGAGGAGGCGTGAATCGCGCAGGAATATTGACTAATTTGGGTGGGGTGGGGGGACGGTGGGCGATGGAGCAAC

CCGAGGACATGGCGTCGCTCAGCGAGTTCGACTCCTTGGCGGGCAGCATCCCGGCTACCAAGGTGGAGATCACGGTGTCATGCAG GAACCTCTTGGACA

AAGACATGTTTTCCAAGTCTGACCCAC TGTGTGTCATGTACACTCAAGGGATGGAGAACAAGCAATGGCGAGAG - UNI29191 - TTCGGACGCAC

CGAGGTCATAGATAACACGCTCAACCCGGACTTCGTGCGCAAGTTCATTGTGGATTACTTCTTTGAGGAGAAGCAGAACCTCCGCTTTGATCT CTACGA

TGTTGACTCCAAGAGCCCGGATCTATCTAAACAC - UNI23593 - GACTTCCTGGGCCAGGCCTTCTGTACCCTTGGAGAAATTGTAGGGTCCTCTG

GGAGCCGTCTGGAGAAGCCTCTCAC GATAGGAACATTCAGCCTCAACTCCCGGACAGGCAAGCCTATGCCCGCCGTGTCTAACGG - UNI33308 - 

TGGTGTCCCAGGGAAGAAATGTGGTACCATCATCCTGTCTGCAGAGGAACTGAGCAACTGCAGG - UNI15875 - - UNI33308 - GATGTGGCC

ACAATGCAGTTCTGTGCCAACAAGCTGGATAAGAAAGATTTCTTCGGGAAATCTGACCCCTTCTTGGTGTTCTACAGGAGCAATGAAGACGGAAC - UN

I13009 - - UNI15875 - - UNI22186 - - UNI33308 - GTTCACCATCTGTCACAAGACGGAGGTCATGAAGAACACCCTCAACCCGGTG

TGGCAAACCTTCTCCATCCCCGTGAGGGCTCTGTGCAACGGAGACTATGACAG - UNI13009 - - UNI18906 - GACCATCAAGGTGGAGGTGT

ATGACTGGGATCGTGACGGCAG - UNI20067 - CCATGACTTCATTGGGGAGTTCACCACCAGCTACCGGGAGCTGGCACGTGGCCAGAGTCAGTTC

AACATCTATGAG GTGATAAATCCAAAAAAGAAAATGAAGAAAAAGAAATACGTGAATTCTGGCACG GTCACCCTGCTTTCCTTTGCGGTAGAGTCAGA

GAGTACCTTCCTGGATTACATCAAAGGAGG GACGCAGATCAACTTCACCGTGGCCATTGACTTCACTGCCTCTAATG GGAATCCCTCACAGTCCACGT

CCCTCCACTACATGAGTCCCTACCAGCTGAACGCCTACGCG GGCGCTGACCGCCGTCGGAGAGATCATTCAGCATTATGA
Translation
   - UNI29191 -   - UNI23593 -   - UNI33308 -  - UNI15875 - - UNI33308 -  - UNI13009 - - UNI15875 - 

- UNI22186 - - UNI33308 - MKNTLNPVWQTFSIPVRALCNGDYDR - UNI13009 - - UNI18906 - RTIKVEVYDWDRDGS - UNI

20067 - SHDFIGEFTTSYRELARGQSQFNIYE VINPKKKMKKKKYVNSGT VTLLSFAVESESTFLDYIKGG GTQINFTVAIDFTASNG GNPSQS

TSLHYMSPYQLNAYA GADRRRRDHSAL
Transcript ENSMUST00000024805
Sequence
CGCCCAGCCCAGGGCTGCAGCCGCTCCGGAGGAGGCGTGAATCGCGCAGGAATATTGACTAATTTGGGTGGGGTGGGGGGACGGTGGGCGATGGAGCAAC

CCGAGGACATGGCGTCGCTCAGCGAGTTCGACTCCTTGGCGGGCAGCATCCCGGCTACCAAGGTGGAGATCACGGTGTCATGCAG GAACCTCTTGGACA

AAGACATGTTTTCCAAGTCTGACCCAC TGTGTGTCATGTACACTCAAGGGATGGAGAACAAGCAATGGCGAGAG - UNI29191 - TTCGGACGCAC

CGAGGTCATAGATAACACGCTCAACCCGGACTTCGTGCGCAAGTTCATTGTGGATTACTTCTTTGAGGAGAAGCAGAACCTCCGCTTTGATCT CTACGA

TGTTGACTCCAAGAGCCCGGATCTATCTAAACAC - UNI23593 - GACTTCCTGGGCCAGGCCTTCTGTACCCTTGGAGAAATTGTAGGGTCCTCTG

GGAGCCGTCTGGAGAAGCCTCTCAC GATAGGAACATTCAGCCTCAACTCCCGGACAGGCAAGCCTATGCCCGCCGTGTCTAACGG - UNI33308 - 

TGGTGTCCCAGGGAAGAAATGTGGTACCATCATCCTGTCTGCAGAGGAACTGAGCAACTGCAGG - UNI15875 - - UNI33308 - GATGTGGCC

ACAATGCAGTTCTGTGCCAACAAGCTGGATAAGAAAGATTTCTTCGGGAAATCTGACCCCTTCTTGGTGTTCTACAGGAGCAATGAAGACGGAAC - UN

I13009 - - UNI15875 - - UNI22186 - - UNI33308 - GTTCACCATCTGTCACAAGACGGAGGTCATGAAGAACACCCTCAACCCGGTG

TGGCAAACCTTCTCCATCCCCGTGAGGGCTCTGTGCAACGGAGACTATGACAG - UNI13009 - - UNI18906 - GACCATCAAGGTGGAGGTGT

ATGACTGGGATCGTGACGGCAG - UNI20067 - CCATGACTTCATTGGGGAGTTCACCACCAGCTACCGGGAGCTGGCACGTGGCCAGAGTCAGTTC

AACATCTATGAG GTGATAAATCCAAAAAAGAAAATGAAGAAAAAGAAATACGTGAATTCTGGCACG GTCACCCTGCTTTCCTTTGCGGTAGAGTCAGA

GAGTACCTTCCTGGATTACATCAAAGGAGG GACGCAGATCAACTTCACCGTGGCCATTGACTTCACTGCCTCTAATG GGAATCCCTCACAGTCCACGT

CCCTCCACTACATGAGTCCCTACCAGCTGAACGCCTACGCGCTGGCGCTGACCGCCGTCGGAGAGATCATTCAGCATTATGACAGTGACAAGATGTTCCC

TGCCCTGGGCTTCGGGGCCAAGCTGCCCCCCGACGGCAGGGTGTCCCATGAGTTTCCCCTG AATGGCAACCAGGAGAACCCCTCCTGCTGTGGCATCGA

TGGCATCCTGGAGGCCTACCACAGCAGCCTGCGCACCGTGCAGCTTTACGGCCCCACTAACTTTGCTCCTGTTGTCACTCACGTAGCCAG GAACGCCGC

AGCTGTGCAGGATGGCTCCCAGTATTCTGTGCTGCTCATCATCACTGATGGTGTCATCTCGGACATGGCACAGACCAAGGAGGCAATTGTAAAT GCTGC

CAAACTCCCTATGTCGATCATCATTGTTGGCGTGGGCCAGGCCGAGTTCGATG CCATGGTGGAGCTGGACGGTGATGACGTGCGGATCTCCTCCAGGGG

GAAGCTGGCTGAGCGAGACATTGTCCAG TTTGTGCCCTTCAGGGACTATGTGGACCGCACCGGCAACCACGTACTGAGCATGGCCCGCCTGGCCCGGGA

TGTTCTGGCTGAGATTCCGGACCAACTGGTGTCCTACATGAAGGCACAGGGCATCCGCCCACGCCCGCCACCTGCTGCACCCGCTCAGTCACCCCCACAG

TCCCCAGCCCACTCACCTCCTGGATCCCCCGTGCACACGCATATCTGAAGCTGAGAGGACCAAGGGCCTGGAGGGTAGACTGACACCCTATTCTCCTCCT

GGTCGGTTTCCCAGACTCTGCTTGGAGGGCCAGCGGGAAATGGGGTGTCAGGGCCTCACCCCACTTCACACCCAAATCCAGGGGACTGTGGTATAGAAGA

CAAGGGGTACACAGATTCTGGGGCTGAGGGGACCCCCCTAGTCCATGCCGGACAACTCCAAGACTTTCTTATTCTTGCAACCCAGCTGGGCCTCTTCCAG

CTCCTGTCTCCTCCTACCCTAGTGTCTAGTGTCCCCAGTCCCATGAGATCCCCTGTCCTGTTTCCAGGGAACCCCAGACTGGTAGACTACCAGGGATGCA

TGTGACCCTCTTAGGGACTCCATATGTGAGCAGATAGAGCCCCTTTCCTGATCCTCAAAGGCTCAGTGGTATGCTAGAATGTTCTAGAATGGTCACTGGA

GCTATCACAGGTAGCTTGTAGCACTGAGATGTCTCCTGCTCAACTTGGGGGCCACTCACCTGCAGGGCACAGGGTTAGCCCCCACACTCCAACTTGCTCC

TGCTCTCTGCCCTTCAGTGGCTAGGGGACAAGAGACAGGGATCCCTGAATGCCAACCTGTCCCTAGCCACATCCAGCAGGAACCCACCCAGCCCACCCTC

TGCTCTCTGGGCCTCAGTGTCCACACCTCCGCAATGACAGGATTTGTCAGGTGGTCCAGCGTTTCCTGAGCCATCCTGAGGGTACATCCATTCCACACAC

AGCCTCCCCACACCTTCCTCATGGCCACCATTCACACCCAGGCCAGCTAGACTCTGGGGTCATCCTGTCGCATCCTGTCACCCCCATGCCTCAGCCCTTC

AAAGCTCCTGTCCCTGCGGTGGGAAGTTAGCAAAGGGCTTTTCACCTAAGGTCACCCCAATGGCCACCGTCCTTTGTCCACTGGGGCAGGTCTTGCATGT

GTCCCTTATGCCGCATGGGGTCTCCACCTGGCATCTCCCATCCCACCTGCCTGTCCCGCATGGTGATAGTGATGTTTTGACTGTCTGGTCCTGTGCCTGT

CTGAGACTGTCTCTGTGGAACTTGCCTTAAATTGAAGTAAACCAGTTCTTTTAGTAGATAGACCCCCCCTCTCCTTTGAAAACAGCTTTGCTGTTTGCCT

AGCATCTATCTCTCTGCTGCCTTGGTTCTTCCGTCCGGCCATGTTCCTGTCAGACTCTGTAAGAGGCATGGGGGGGGGGGTGCATGGCGAGGATTGAAAC

CCACCACCCACAAACATATGTAAGCAGAGTCTGTGAGCCATCAGGGACTGTGATGGAGGCATGGTTGCCTAGAGCCCCTTCCCGGTCCTCAGAGGCTCAG

TGGTATGCTAGAATGTTCTAGATGTGGATCTCTAGCCTCACTAGAGCTGTCACGAGTAGCTTGTGACATTGAGAGGTCTCCTGCTCAACTCGGAAGCCAC

TCACCTGCCGGGCACATGACCAGAGCCTGGACGCCAACATGAGAGACAGTGAGCACACACACACACTCAGGTCTATAGTCTGGCTTCAGACAGTGTTAAG

AGGCAGGAGCAAGGGGAGAGAATGAGAGCAGACTCCAGTAGAGAGATGTTTGAGACGAGCAGGGGTGTTGAGGGGAGCCCAAGAGAAATGAGCAGGGAGC

CATGCTGATGCCAGGGTGAAGAGGACTCTGGTAGTTTGGGATAAGTTTGTGCCAGGTAGGAGCCTAGTGTGTTTGACGGGAGGCAAGCACGCGGGTGTGA

TAGGAGCTAACCAAGGAAGAGAATGCAGGCGATGGGGTCAGGGTGGAGGCCAAAATGCACAGGGCCTTGTGGTTCATGGCAAGGCATCTGACGTTTGCTC

TAGAGGGTTGTAGCCATTAAGGAAGTAAGAGAGACGAGCACGTGACCCAAACCTCCCCAACACATGGATCGCTATCACCGTGGATCATGGTTTCTTCATC

TCTCAACAAACATCTACTGAGAATCCATTCCAGGCCTGTGCAGAGGTCAGAGGCACTTGGCTCAGTCCCCAGTGTCTCCCTCTGGGCTAAATCAGCCACC

ACAAAGTAGCAATGCCAGCCAGCTTGAAGGGATGGGAGTGGTGGCACTAAGAGACACTCTGGCCCATACCGGATGACCCCCCACCCGGGGTGTGGCCACC

ATAGTGTCAGGTGGGGTACATGTGTGCACAGATGGTGACATTGGCAGGCTCTGTGGGTGGACCACGCAGGACTTATGTGACTTCAGGGACACGGTAAGCA

TCTTCCGTGGTCCCTTTCTACAGGTCAGGGCCTTCACCAATGTGGAGCATGGGAGCAAGGACATACGCGCATGCGCACAGCACATACTGCGCACGCTGTC

CCATCAGCCCTCTAGGCAGCCATTCTGAGGCTGTACCCAAGAGGAATTCGGTACCAATTACCCTCCAGCTCGGGGCTTGTTTACTTCTGATGACTTCATG

GTAAATTAGAGCTGACTC
Translation
MEQPEDMASLSEFDSLAGSIPATKVEITVSCR RNLLDKDMFSKSDPL LCVMYTQGMENKQWRE - UNI29191 - FGRTEVIDNTLNPDFVRKFIV

DYFFEEKQNLRFDL LYDVDSKSPDLSKH - UNI23593 - DFLGQAFCTLGEIVGSSGSRLEKPLT TIGTFSLNSRTGKPMPAVSNG - UNI333

08 - GGVPGKKCGTIILSAEELSNCR - UNI15875 - - UNI33308 - DVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGT - UNI13009

 - - UNI15875 - - UNI22186 - - UNI33308 - TFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDR - UNI13009 - - UNI189

06 - RTIKVEVYDWDRDGS - UNI20067 - SHDFIGEFTTSYRELARGQSQFNIYE VINPKKKMKKKKYVNSGT VTLLSFAVESESTFLDYIKG

G GTQINFTVAIDFTASNG GNPSQSTSLHYMSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPL NGNQENPSCCGIDGILEA

YHSSLRTVQLYGPTNFAPVVTHVAR RNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVN AAKLPMSIIIVGVGQAEFDA AMVELDGDDVRISSRGK

LAERDIVQ FVPFRDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPAQSPPQSPAHSPPGSPVHTHI

For any suggestions or comments, please send an email to unitrap@crg.es