Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024018 (1110021J02Rik)
Chromosomal location
Chr 17: 29837173 - 29853956 (-)
Description
RIKEN cDNA 1110021J02 gene Gene [Source:MGI Symbol;Acc:MGI:1915847]
MGI
MGI:1915847 
Uniprot/SWISSPROT
Q9D162 
Human Ortholog
ENSG00000198937 (C6orf129)
Omim not available
UniTrap UNI4977
Vector Insertion
Chr 17: 29842529 - 29853878
Public Clones XS0836 (sanger) D170D06 (ggtc) (ggtc) IST15045C11 (tigm) IST14754H2 (tigm)
Private Clones OST422847 (lexicon) OST378751 (lexicon) OST290472 (lexicon) OST280461 (lexicon)
OST271427 (lexicon) OST201866 (lexicon) OST194727 (lexicon) OST184488 (lexicon)
OST167794 (lexicon) OST148959 (lexicon) OST148941 (lexicon) OST104710 (lexicon)
OST63848 (lexicon) OST59798 (lexicon) OST59488 (lexicon) OST56670 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21238
Vector Insertion
Chr 17: 29841415 - 29842215
Public Clones not available
Private Clones OST337482 (lexicon) OST221345 (lexicon) OST184392 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114648
Sequence
ATGGGCTGGTCCAGCGCGGAAAAGACAGCAAGCAATATGACTAAAAAGAAGCGGGAGAATCTTGGTGTCGCTCAGGAG - UNI4977 - ATTGACGGG

CTAGAGGAAAAGCTGTCCCGGTGTCGGAAGGACCTGGAGGCCGTGACCTCCCAGCTTTACAGGGCAGAGCTCAGTCCTGAGGACAG GAGGTCTCTGGAG

AAGGAGAAACACACCCTCATGAACAAAGCCTCCAAGTATG - UNI21238 - AGAAAGAGCTAAAGCTGCTTCGACATGAGAACCGGAAGAACACGCT

CCTCTCGGTGGCCATCTTCACTGTCTTCGCCCTGCTCTATGCTTACTGGACTATGTGAGTCAGCCATCTCCAGCCACTAGAAGGACGTGGTAGTGCTTCC

TTCTGCTTAGTAGAGGGGCAATAAAGAGCCCCAGGCTCTGCTGTCTGGCAACTATTTCCTGCTGACAAGGTGAGGGTGAGCAAGGGAGGCACTCTTATTT

CAAAGATGAAGGGATGTTCCAAAATTCTTATGTACAATTCAGGAGGAAGGGAGATGTGCAGCTGGGAGGGCAAGCTCTGTGCCTGCCACCCGCAGCTCCA

GCCTGCCCTGGCCTGTGATTATTACCACTGAAGAAAATGCAGCATGCACGGGAAAAGGTGGCCTGGGCTTGAAGTGGAGGTTCCAGGGGTATGCGGAATC

ATCTCCTCTTCCAGAGACAGGCAGGGCCAGGGAGGCCTGCAGGTGCCCATGGCCAGCAAGTCTGGCAATGACCAGACTGACATGGTGACAAGAGCCAGTG

AGTAGGGTGGGGGTGAGAAGGAGGAGGTGGTCAGTCAGGAGCAGCCCCTAGGATTCTCCCCTAGCTCCACTCACAGTAGAGGGCCCTAAGGGAGAAAGAA

TGCTCACTGCTCCATTCAGGAGCCTGCCAAGTAAAGCCAGGCTGTGAAACATGAAGAATCGGCTGGAGGCAGCTCACCAACATGTGCGATGTTCAGGTGA

AGGAATTCTCACCTGGGGCTCATGCAGAATGTGGCCTCTTGTGGAGGCGGCTAGCCAGAGTCAGCAGAAGATCCTTTCTCCTGTCTCGTCTAGTGACAGT

AATTGGTCTGAAGCCTCTGCTATGTTAGTCACACAGACTGATCCTGGACTGCCACAGTGCTGCCATGCCATGCAGTGAGTTGTGTGGTGAGCTCATTCAC

CCCCAAGTTCTGCTTTATACCGGAACTGTACTTTGATAAGCCTTTGGGCTCCCTGTCTAGCAGATGGCAGTCTCAGGAGCTGGAGAAGCTTGGCTTCCAC

AAACACTCCCCTTCCTCAGTTACACAGCACTGTGGACAACAGCAGCCCAGCACAGAGCCACATGAGCAGTAAAAATATGTTTAATGATCC
Translation
MGWSSAEKTASNMTKKKRENLGVAQE - UNI4977 - IDGLEEKLSRCRKDLEAVTSQLYRAELSPEDR RRSLEKEKHTLMNKASKYE - UNI212

38 - EKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM
Transcript ENSMUST00000024815
Sequence
GGAAAAGACAGCAAGCAATATGACTAAAAAGAAGCGGGAGAATCTTGGTGTCGCTCAGGAG - UNI4977 - ATTGACGGGCTAGAGGAAAAGCTGTC

CCGGTGTCGGAAGGACCTGGAGGCCGTGACCTCCCAGCTTTACAGGGCAGAGCTCAGTCCTGAGGACAG GAGGTCTCTGGAGAAGGAGAAACACACCCT

CATGAACAAAGCCTCCAAGTATG - UNI21238 - AGAAAGAGCTAAAGCTGCTTCGACATGAGAACCGGAAGAACACGCTCCTCTCGGTGGCCATCT

TCACTGTCTTCGCCCTGCTCTATGCTTACTGGACTAT CCGATACACCTCCTTCACCCTGTGA
Translation
ASNMTKKKRENLGVAQE - UNI4977 - IDGLEEKLSRCRKDLEAVTSQLYRAELSPEDR RRSLEKEKHTLMNKASKYE - UNI21238 - EKEL

KLLRHENRKNTLLSVAIFTVFALLYAYWTI IRYTSFTL

For any suggestions or comments, please send an email to unitrap@crg.es