Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000024049 (Myom1)
Chromosomal location
Chr 17: 71368861 - 71476195 (+)
Description
myomesin 1 Gene [Source:MGI Symbol;Acc:MGI:1341430]
RefSeq_dna
NM_010867 
RefSeq_peptide
NP_001077403.1 NP_034997.2 
UniGene
Mm.4103 
MGI
MGI:1341430 
Uniprot/SWISSPROT
Q62234 
Human Ortholog
ENSG00000101605 (MYOM1)
Omim not available
UniTrap UNI37774
Vector Insertion
Chr 17: 71384052 - 71385613
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30387
Vector Insertion
Chr 17: 71386714 - 71393825
Public Clones CMHD-GT_432D6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38658
Vector Insertion
Chr 17: 71395137 - 71397063
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024847
Sequence
CTGGCCCCCAGAATCCAGCCTCTAGCCCTGCCTCTTAACTTTTTCTTGGATTCAACCTAGGTGGGCCCTCATTCTCTCCTGCTCCTCGACTGCGGCAGGG

CAGTGGGCCGTAACCCCCACCCCAGAAACCG GTCTTCTCGTCCCCTGGAGGGCCCAGGATGTCTCTGCCCTTTTATCAGCGGTCCCATCAGCACTATGA

TCTCAGTTACCGGAACAAGGACCTTCGCACGACCATGAGCCACTACCAACAGGAGAAGAAGCGCTCTGCTGTCTACACCCATGGCTCCACTGCCTACAGC

AGCCGCTCCTTGGCAGCACGCCGCCAGGAGTCAGAGGCCTTCAGTCAAGCATCAGCCACCTCTTACCAGCAGCAGGCCTCACAGACCTACAGTCTTGGAG

CATCATCATCATCCCGGCATTCTCAAGGGTCTGAAGTCAGCCGGAAGACAGCCTCTGCATATGATTACGGCTATTCCCACGG ACTCACAGATTCCAGTC

TGCTATTAGAAGATTATTCATCCAAGTTGAGCCCCCAAACAAAGAGAGCCAAGCGGAGCCTTCTGTCTGGAGAGGAGACTGGAAGCTTGCCAGGCAACTA

CCTGGTGCCTATCTACTCTGGACG GCAAGTGCACATCAGTGGGATCAGAGACTCGGAAGAAGAAAGAATTAAAGAGGCTGCTGCTTATATCGCTCAGAA

GACTCTCCTTGCGAGTGAGGAAGCTATTGCAGCTTCCAAACAGAGCACAGCCTCCAAACAGTCCGCAACCTCCAAACGGACCACGTCCACCCTTCAACGA

GAGGAAACGTTTGAAAAGAAGTCGAGGAACATTGCAATTCGAGAAAAGGCGGAAGAGCTGTCACTGAAGAAAACA TTAGAAGAGACCCAAACATATCAC

GGCAAGCTAAATGAAGACCATCTCCTTCATGCTCCTGAGTTTATCATTAAGCCTCGTTCTCACACAGTTTGGGAGAAGGAGAATGTGAAGTTGCACTGCT

CTGTAGCAGGGTGGCCAGAGCCTCGGCTCACGTG - UNI30387 - GTATAAGAACCAGGTGCCTATAAATGTCCATGCAAACCCGGGAAAGTACATC

ATTGAAAGCCGATACGGAATGCATACTCTTGAGATCAGCAA ATGTGACTTTGAAGACACAGCTCAGTACCGGGCCTCGGCGATGAATGTTCAAGGAGAG

CTGTCAGCATATGCCTCAGTCGTAGTAAAGA GATATAAGGGAGAACTGGATGAGTCTCTCCTCCGTGGTGGGGTTTCCATGCCTCTCAGCT TTGCTGT

GACCCCTTACGGTTATGCATCCAAGTTTGAGATCCACTTCGATGACAAGTTTGATGTGTCTTTTGGGAGAGAAGGAGAGACCATGAGTCTGGGCTGTCGC

GTAGTCATCACTCCTGAGATAAAGCACTTTCAGCCCGAGGTCCAGTGGTATAGAAATG GAGCACCTGTTTCTCCATCAAAATGGGTGCAGCCACACTGG

AGTGGAGACCGGGCGACACTTACGTTCTCTCACCTCAACAAAGAAGATGAAGGTCTCTACACGATCCGAGTGCGAATGGGAGAGTATTACGAACAGTACA

GTGCTTACGTCTTTGTTCGAG ATGCTGATGCAGAGATCGAAGGAGCCCCAGCTGCACCCTTGGATGTGGTGTCTTTGGATGCTAACAAGGATTACATCA

TCATCTCTTGGAAGCAGCCAGCTGTGGATGGAGGGAGCCCTATCCTGGGATACTTTATCGATAA GTGTGAGGTGGGCACAGATACCTGGTCTCAGTGCA

ATGACACACCTGTGAAGTTTGCTCGGTTTCCAGTCACTGGCTTGATAGAAGGCCGTTCCTACATATTCAGAGTCCGAGCTGTGAATAAAACTGGAATAGG

CCTGCCATCCCGAGTTTCTGAGCCTGTGGCGGCTTTGGATCCAGCTGAGAAAGCTAGACTAAAAA GTCATCCTTCAGCACCCTGGACTGGACAGATCAT

TGTCACGGAAGAAGAGCCTACAG AGGGTGTCATTCCTGGCCCCCCCACAGACCTCTCTGTCACCGAGGCCACCCGGAGCTACGTAGTGCTGAGCTGGAA

ACCCCCTGGGCAGCGAGGCCATGAGGGCATTATGTATTTTGTAGAAAAG TGTGATGTGGGAGCAGAAAACTGGCAGCGGGTCAACACAGAACTCCCGGT

GAAGTCTCCTCGCTTTGCTCTGTTTGACCTGGTGGAGGGGAAGTCTTACCGCTTCCGTGTCCGCTGCTCAAATTCAGCAGGAGTTGGTGAGCCCTCAGAA

ACGACTGAAGTGACCGTCGTAGGGGACAAACTTG ATATCCCAAAGGCCCCTGGCAAAATCATCCCAAGTAGAAATACAGATACCTCAGTGGTGGTATCT

TGGGAGGAGTCCAGAGACGCCAAGGAACTGGTTGGGTACTACATCGAGGCCAGTGTCGTTGGCTCTGGCAAGTGGGAACCCTGCAATAACAACCCGGTGA

AGGGCTCACG ATTTACTTGTCATGGACTGACGACTGCTCAGAGCTATATTTTCCGGGTCAGAGCAGTGAATGCAGCTGGACTTAGCGAATATTCACAGG

ATTCGGAAGCTATTGAAGTCAAAGCTGCTATCG CCGTGCCATCTGCGCCCTATGACATCACTTGTCTTGAAAGTTTTCGGGACTCCATGGTTCTTGGAT

GGAAGCAGCCAGATACGACCGGAGGGGCAGAGATTACAGGCTATTATGTGAACTATCGTGAGGTGGTTGGTGAGGTACCAGGAAAATGGAGGGAAGCTAA

CATCAAGGCCGTCAGCGATGCAGCGTACAAG ATTAGCAACTTGAAGGAAAACACACTGTACCAGTTCCAAGTGTCAGCAATGAACATTGCAGGGCTGGG

AGCGCCCTCCACGGTGAGCGAGTGCTTCAAGTGTGAAGAGTGGACCATTGCTGTTCCAG GACCACCACACAGCGTGAAGCTCAGTGAAGTCAGGAAGAA

CTCCCTGGTTCTCCAGTGGAAGCCTCCAGTCTACTCAGGCCGGACTCCAGTCACGGGTTACTTTGTGGACCTGAAGGAAGCCAGTGCCAAAGATGACCAA

TGGCGAGGACTTAATGAGGCAGCCATTGTGAACAAGTACCTGAGG GTGCAAGGCCTCAAAGAGGGTACCAGCTACGTGTTCCGTGTACGTGCTGTCAAC

CAGGCAGGCGTTGGAAAGCCTTCAGACCTTGCTGGACCTGTTGTGGCTGAAACACGTCCAG GCACCAAAGAGGTTGTGGTGAGTGTGGATGATGACGGA

GTCATTTCCTTGAACTTTGAATGTGATCAGATGACTCCCAAGTCAGAATTCGTCTGGTCCAAAGATTATGTACCTACTGAAGACTCTCCACGATTAGAAG

TCGAAAACAAAGGCGATAA GACAAAAATGACCTTTAAAGACCTCGGGACAGATGATTTGGGCACCTATTCTTGTGATGTGACAGACACGGATGGGATAG

CGTCAAGCTACCTGATAGACGAGGAGG AAATGAAACGTCTGCTTGCCCTCAGCCAGGAGCACAAGTTCCCGA CTGTCCCAACTAAGTCTGAGTTGGCA

GTTGAAATTTTGGAGAAAGGTCAGGTCCGGTTTTGGATGCAGGCTGAGAAGCTGTCTAGCAATGCCAAAGTCAGCTACATATTTAACGAGAAGGAAATTT

TCGAGGGGCCG AAATACAAGATGCACATAGACCGAAACACGGGCATCATTGAAATGTTCATGGAGAAGCTACAGGACGAGGATGAAGGGACGTACACAT

TCCAAATTCAAGATGGAAAAGCAACTGGCCATTCGACTCTTGTTCTCATTGGAGACG TTTATAAGAAGCTACAGAAAGAAGCTGAATTCCAGCGACAAG

AATGGATCAGGAAGCAAG GCCCACATTTCGCTGAGTATTTGAGCTGGGAAGTGACTGGTGAATGTAACGTGCTGTTGAAATGCAAG GTGGCAAATATT

AAAAAAGAGACTCACATTGTATGGTACAAAGATGAACGGGAGATCTCCGTGGACGAGAAACATGACTTTAAGGATGGCATTTGTACCCTGCTCATCACAG

AG TTTTCCAAGAAAGACGCTGGATTTTATGAAGTTATCCTGAAAGATGACCGAGGAAAAGATAAGAGCAGATTGAAGCTCGTGGATGAAG CCTTCCAA

GACTTGATGACTGAAGTATGCAAGAAGATAG CGTTGTCTGCCACAGACCTGAAAATCCAGAGCACAGCGGAGGGCATCCGGCTATACTCCTTTGTCTGT

TATTACCTGGATGACTTGAAAGTTAACTGGTCCCACAA TGGGACGGGGATTAAGTACACAGACAGAGTCAAGAGTGGCGTGACTGGGGAGCAGATCTGG

CTGCAGATCAACGAGCCCACTCCGAATGATAAAGGGAAATACGTGATGGAGCTCTTTGACGGCAAGACTGGACACCAGAAGACGGTGGATCTCTCTGGAC

AAG CATTTGATGAGGCCTTTGCTGAATTCCAGAGGTTAAA ACAAGCTGCCATTGCTGAAAAAA ATCGGGCCCGGGTGTTAGGTGGTCTCCCTGATGT

TGTCACCATTCAAGAGGGCAAG GCACTCAATCTCACTTGCAATGTGTGGGGTGACCCGCCCCCTGAGGTGTCCTGGCTGAAAAACGAGAAGCCACTGAC

CTCTGACGACCACTGCAGCCTCAAGTTTGAGGCCGGGAAAACCGCCTTCTTCACCATCTCAGGCGTGAGCACGGCAGACTCCGGCAAGTACGGGCTGGTG

GTGAAGAACAAATATGGCTCGGAGACCAGCGACTTCACCGTTAGTGTGTTCATCCCAGAGGAGGAGTTGAGGAAGGGAGCAATGGAGCCTCCCAAGGGCA

ACCAGAAGTCCAAGTGAGCAGAGACTGGGGGAGTTTTGAGGAGAGCCAGGACCAGCTGGCCACCCATCATGCTGCTGTCGTGAAAAGGATTGGGCTACAG

ACGATGAAATCCTCCTGGTGGCTCCATTTTGTGCTGGCTTAGGAGGAAGTCATCAGATCTCTTATTCCTATAGATGAGGAGGCACCATTGAAGAACACAT

TAAGGGTTTTAATCTACAATTTATGTAGTAAGAAAACATTAGGAAATGATTTCAAGGAAGAAGGGCAGAGGATGTTGGAGAAGTGCTGAGCGAGAGCAGA

AGTGAGGCCAGCATGGAAGCCGGTGACGCTTTACCTGTAAGCTCTTAGGAATTGTGTCCATACCTCATGTTCTATCAAAATAGAGGCATGTGCCTGTAGG

CTTGAGTATGGTGGGTCCCTGTTAGTAGAGGTGGTGCATTTCTGATAGCAGCCTTGTGAACTGGCCTCCCCCAGTGTGAATAAAGTCTCCTGCCTTTCCT

CTT
Translation
 MSLPFYQRSHQHYDLSYRNKDLRTTMSHYQQEKKRSAVYTHGSTAYSSRSLAARRQESEAFSQASATSYQQQASQTYSLGASSSSRHSQGSEVSRKTAS

AYDYGYSHG GLTDSSLLLEDYSSKLSPQTKRAKRSLLSGEETGSLPGNYLVPIYSGR RQVHISGIRDSEEERIKEAAAYIAQKTLLASEEAIAASKQS

TASKQSATSKRTTSTLQREETFEKKSRNIAIREKAEELSLKKT LEETQTYHGKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSVAGWPEPRLTW - 

UNI30387 - WYKNQVPINVHANPGKYIIESRYGMHTLEISK KCDFEDTAQYRASAMNVQGELSAYASVVVKR RYKGELDESLLRGGVSMPLSF FA

VTPYGYASKFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEVQWYRNG GAPVSPSKWVQPHWSGDRATLTFSHLNKEDEGLYTIRVRMGEYYE

QYSAYVFVRD DADAEIEGAPAAPLDVVSLDANKDYIIISWKQPAVDGGSPILGYFIDK KCEVGTDTWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAV

NKTGIGLPSRVSEPVAALDPAEKARLKS SHPSAPWTGQIIVTEEEPTE EGVIPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK CDVGAEN

WQRVNTELPVKSPRFALFDLVEGKSYRFRVRCSNSAGVGEPSETTEVTVVGDKLD DIPKAPGKIIPSRNTDTSVVVSWEESRDAKELVGYYIEASVVGS

GKWEPCNNNPVKGSR RFTCHGLTTAQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIA AVPSAPYDITCLESFRDSMVLGWKQPDTTGGAEITGYYVNY

REVVGEVPGKWREANIKAVSDAAYK ISNLKENTLYQFQVSAMNIAGLGAPSTVSECFKCEEWTIAVPG GPPHSVKLSEVRKNSLVLQWKPPVYSGRTP

VTGYFVDLKEASAKDDQWRGLNEAAIVNKYLR VQGLKEGTSYVFRVRAVNQAGVGKPSDLAGPVVAETRPG GTKEVVVSVDDDGVISLNFECDQMTPK

SEFVWSKDYVPTEDSPRLEVENKGDK KTKMTFKDLGTDDLGTYSCDVTDTDGIASSYLIDEEE EMKRLLALSQEHKFPT TVPTKSELAVEILEKGQV

RFWMQAEKLSSNAKVSYIFNEKEIFEGP KYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDV VYKKLQKEAEFQRQEWIRKQG

 GPHFAEYLSWEVTGECNVLLKCK VANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITE FSKKDAGFYEVILKDDRGKDKSRLKLVDEA AFQDL

MTEVCKKIA ALSATDLKIQSTAEGIRLYSFVCYYLDDLKVNWSHN NGTGIKYTDRVKSGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLS

GQA AFDEAFAEFQRLK KQAAIAEKN NRARVLGGLPDVVTIQEGK ALNLTCNVWGDPPPEVSWLKNEKPLTSDDHCSLKFEAGKTAFFTISGVSTAD

SGKYGLVVKNKYGSETSDFTVSVFIPEEELRKGAMEPPKGNQKSK
Transcript ENSMUST00000073211
Sequence
CTGGCCCCCAGAATCCAGCCTCTAGCCCTGCCTCTTAACTTTTTCTTGGATTCAACCTAGGTGGGCCCTCATTCTCTCCTGCTCCTCGACTGCGGCAGGG

CAGTGGGCCGTAACCCCCACCCCAGAAACCG GTCTTCTCGTCCCCTGGAGGGCCCAGGATGTCTCTGCCCTTTTATCAGCGGTCCCATCAGCACTATGA

TCTCAGTTACCGGAACAAGGACCTTCGCACGACCATGAGCCACTACCAACAGGAGAAGAAGCGCTCTGCTGTCTACACCCATGGCTCCACTGCCTACAGC

AGCCGCTCCTTGGCAGCACGCCGCCAGGAGTCAGAGGCCTTCAGTCAAGCATCAGCCACCTCTTACCAGCAGCAGGCCTCACAGACCTACAGTCTTGGAG

CATCATCATCATCCCGGCATTCTCAAGGGTCTGAAGTCAGCCGGAAGACAGCCTCTGCATATGATTACGGCTATTCCCACGG ACTCACAGATTCCAGTC

TGCTATTAGAAGATTATTCATCCAAGTTGAGCCCCCAAACAAAGAGAGCCAAGCGGAGCCTTCTGTCTGGAGAGGAGACTGGAAGCTTGCCAGGCAACTA

CCTGGTGCCTATCTACTCTGGACG GCAAGTGCACATCAGTGGGATCAGAGACTCGGAAGAAGAAAGAATTAAAGAGGCTGCTGCTTATATCGCTCAGAA

GACTCTCCTTGCGAGTGAGGAAGCTATTGCAGCTTCCAAACAGAGCACAGCCTCCAAACAGTCCGCAACCTCCAAACGGACCACGTCCACCCTTCAACGA

GAGGAAACGTTTGAAAAGAAGTCGAGGAACATTGCAATTCGAGAAAAGGCGGAAGAGCTGTCACTGAAGAAAACA TTAGAAGAGACCCAAACATATCAC

GGCAAGCTAAATGAAGACCATCTCCTTCATGCTCCTGAGTTTATCATTAAGCCTCGTTCTCACACAGTTTGGGAGAAGGAGAATGTGAAGTTGCACTGCT

CTGTAGCAGGGTGGCCAGAGCCTCGGCTCACGTG - UNI30387 - GTATAAGAACCAGGTGCCTATAAATGTCCATGCAAACCCGGGAAAGTACATC

ATTGAAAGCCGATACGGAATGCATACTCTTGAGATCAGCAA ATGTGACTTTGAAGACACAGCTCAGTACCGGGCCTCGGCGATGAATGTTCAAGGAGAG

CTGTCAGCATATGCCTCAGTCGTAGTAAAGA GATATAAGGGAGAACTGGATGAGTCTCTCCTCCGTGGTGGGGTTTCCATGCCTCTCAGCT TTGCTGT

GACCCCTTACGGTTATGCATCCAAGTTTGAGATCCACTTCGATGACAAGTTTGATGTGTCTTTTGGGAGAGAAGGAGAGACCATGAGTCTGGGCTGTCGC

GTAGTCATCACTCCTGAGATAAAGCACTTTCAGCCCGAGGTCCAGTGGTATAGAAATG GAGCACCTGTTTCTCCATCAAAATGGGTGCAGCCACACTGG

AGTGGAGACCGGGCGACACTTACGTTCTCTCACCTCAACAAAGAAGATGAAGGTCTCTACACGATCCGAGTGCGAATGGGAGAGTATTACGAACAGTACA

GTGCTTACGTCTTTGTTCGAG ATGCTGATGCAGAGATCGAAGGAGCCCCAGCTGCACCCTTGGATGTGGTGTCTTTGGATGCTAACAAGGATTACATCA

TCATCTCTTGGAAGCAGCCAGCTGTGGATGGAGGGAGCCCTATCCTGGGATACTTTATCGATAA GTGTGAGGTGGGCACAGATACCTGGTCTCAGTGCA

ATGACACACCTGTGAAGTTTGCTCGGTTTCCAGTCACTGGCTTGATAGAAGGCCGTTCCTACATATTCAGAGTCCGAGCTGTGAATAAAACTGGAATAGG

CCTGCCATCCCGAGTTTCTGAGCCTGTGGCGGCTTTGGATCCAGCTGAGAAAGCTAGACTAAAAA GTCATCCTTCAGCACCCTGGACTGGACAGATCAT

TGTCACGGAAGAAGAGCCTACAG AGGGTGTCATTCCTGGCCCCCCCACAGACCTCTCTGTCACCGAGGCCACCCGGAGCTACGTAGTGCTGAGCTGGAA

ACCCCCTGGGCAGCGAGGCCATGAGGGCATTATGTATTTTGTAGAAAAG TGTGATGTGGGAGCAGAAAACTGGCAGCGGGTCAACACAGAACTCCCGGT

GAAGTCTCCTCGCTTTGCTCTGTTTGACCTGGTGGAGGGGAAGTCTTACCGCTTCCGTGTCCGCTGCTCAAATTCAGCAGGAGTTGGTGAGCCCTCAGAA

ACGACTGAAGTGACCGTCGTAGGGGACAAACTTG ATATCCCAAAGGCCCCTGGCAAAATCATCCCAAGTAGAAATACAGATACCTCAGTGGTGGTATCT

TGGGAGGAGTCCAGAGACGCCAAGGAACTGGTTGGGTACTACATCGAGGCCAGTGTCGTTGGCTCTGGCAAGTGGGAACCCTGCAATAACAACCCGGTGA

AGGGCTCACG ATTTACTTGTCATGGACTGACGACTGCTCAGAGCTATATTTTCCGGGTCAGAGCAGTGAATGCAGCTGGACTTAGCGAATATTCACAGG

ATTCGGAAGCTATTGAAGTCAAAGCTGCTATCG GGGGAGGAGTGTCTCCAGATGTGTGGCCTCAACTGAGTGATACGCCTGGTGGACTAACAGACTCCA

GGGGGGGCATGAATGGAGCCTCCCCACCAACCTCTCAGAAAGATGCTTTGCTCGGTAGCAACCCTAATAAGCCCTCACCACCCAGTAGCCCTTCCAGCCG

GGGCCAGAAAGAAGTAAGTACAGTGAGTGAGTCAGTTCAGGAGCCGCTCAGCTCGCCGCCCCAGGAAGCAGCTCCCGAGGAGGAGCAAAGTCAATCCGAG

CCCCCGAAAAAGAAGAAAGATCCAGTAG CCGTGCCATCTGCGCCCTATGACATCACTTGTCTTGAAAGTTTTCGGGACTCCATGGTTCTTGGATGGAAG

CAGCCAGATACGACCGGAGGGGCAGAGATTACAGGCTATTATGTGAACTATCGTGAGGTGGTTGGTGAGGTACCAGGAAAATGGAGGGAAGCTAACATCA

AGGCCGTCAGCGATGCAGCGTACAAG ATTAGCAACTTGAAGGAAAACACACTGTACCAGTTCCAAGTGTCAGCAATGAACATTGCAGGGCTGGGAGCGC

CCTCCACGGTGAGCGAGTGCTTCAAGTGTGAAGAGTGGACCATTGCTGTTCCAG GACCACCACACAGCGTGAAGCTCAGTGAAGTCAGGAAGAACTCCC

TGGTTCTCCAGTGGAAGCCTCCAGTCTACTCAGGCCGGACTCCAGTCACGGGTTACTTTGTGGACCTGAAGGAAGCCAGTGCCAAAGATGACCAATGGCG

AGGACTTAATGAGGCAGCCATTGTGAACAAGTACCTGAGG GTGCAAGGCCTCAAAGAGGGTACCAGCTACGTGTTCCGTGTACGTGCTGTCAACCAGGC

AGGCGTTGGAAAGCCTTCAGACCTTGCTGGACCTGTTGTGGCTGAAACACGTCCAG GCACCAAAGAGGTTGTGGTGAGTGTGGATGATGACGGAGTCAT

TTCCTTGAACTTTGAATGTGATCAGATGACTCCCAAGTCAGAATTCGTCTGGTCCAAAGATTATGTACCTACTGAAGACTCTCCACGATTAGAAGTCGAA

AACAAAGGCGATAA GACAAAAATGACCTTTAAAGACCTCGGGACAGATGATTTGGGCACCTATTCTTGTGATGTGACAGACACGGATGGGATAGCGTCA

AGCTACCTGATAGACGAGGAGG AAATGAAACGTCTGCTTGCCCTCAGCCAGGAGCACAAGTTCCCGA CTGTCCCAACTAAGTCTGAGTTGGCAGTTGA

AATTTTGGAGAAAGGTCAGGTCCGGTTTTGGATGCAGGCTGAGAAGCTGTCTAGCAATGCCAAAGTCAGCTACATATTTAACGAGAAGGAAATTTTCGAG

GGGCCG AAATACAAGATGCACATAGACCGAAACACGGGCATCATTGAAATGTTCATGGAGAAGCTACAGGACGAGGATGAAGGGACGTACACATTCCAA

ATTCAAGATGGAAAAGCAACTGGCCATTCGACTCTTGTTCTCATTGGAGACG TTTATAAGAAGCTACAGAAAGAAGCTGAATTCCAGCGACAAGAATGG

ATCAGGAAGCAAG GCCCACATTTCGCTGAGTATTTGAGCTGGGAAGTGACTGGTGAATGTAACGTGCTGTTGAAATGCAAG GTGGCAAATATTAAAAA

AGAGACTCACATTGTATGGTACAAAGATGAACGGGAGATCTCCGTGGACGAGAAACATGACTTTAAGGATGGCATTTGTACCCTGCTCATCACAGAG TT

TTCCAAGAAAGACGCTGGATTTTATGAAGTTATCCTGAAAGATGACCGAGGAAAAGATAAGAGCAGATTGAAGCTCGTGGATGAAG CCTTCCAAGACTT

GATGACTGAAGTATGCAAGAAGATAG CGTTGTCTGCCACAGACCTGAAAATCCAGAGCACAGCGGAGGGCATCCGGCTATACTCCTTTGTCTGTTATTA

CCTGGATGACTTGAAAGTTAACTGGTCCCACAA TGGGACGGGGATTAAGTACACAGACAGAGTCAAGAGTGGCGTGACTGGGGAGCAGATCTGGCTGCA

GATCAACGAGCCCACTCCGAATGATAAAGGGAAATACGTGATGGAGCTCTTTGACGGCAAGACTGGACACCAGAAGACGGTGGATCTCTCTGGACAAG C

ATTTGATGAGGCCTTTGCTGAATTCCAGAGGTTAAA ACAAGCTGCCATTGCTGAAAAAA ATCGGGCCCGGGTGTTAGGTGGTCTCCCTGATGTTGTCA

CCATTCAAGAGGGCAAG GCACTCAATCTCACTTGCAATGTGTGGGGTGACCCGCCCCCTGAGGTGTCCTGGCTGAAAAACGAGAAGCCACTGACCTCTG

ACGACCACTGCAGCCTCAAGTTTGAGGCCGGGAAAACCGCCTTCTTCACCATCTCAGGCGTGAGCACGGCAGACTCCGGCAAGTACGGGCTGGTGGTGAA

GAACAAATATGGCTCGGAGACCAGCGACTTCACCGTTAGTGTGTTCATCCCAGAGGAGGAGTTGAGGAAGGGAGCAATGGAGCCTCCCAAGGGCAACCAG

AAGTCCAAGTGAGCAGAGACTGGGGGAGTTTTGAGGAGAGCCAGGACCAGCTGGCCACCCATCATGCTGCTGTCGTGAAAAGGATTGGGCTACAGACGAT

GAAATCCTCCTGGTGGCTCCATTTTGTGCTGGCTTAGGAGGAAGTCATCAGATCTCTTATTCCTATAGATGAGGAGGCACCATTGAAGAACACATTAAGG

GTTTTAATCTACAATTTATGTAGTAAGAAAACATTAGGAAATGATTTCAAGGAAGAAGGGCAGAGGATGTTGGAGAAGTGCTGAGCGAGAGCAGAAGTGA

GGCCAGCATGGAAGCCGGTGACGCTTTACCTGTAAGCTCTTAGGAATTGTGTCCATACCTCATGTTCTATCAAAATAGAGGCATGTGCCTGTAGGCTTGA

GTATGGTGGGTCCCTGTTAGTAGAGGTGGTGCATTTCTGATAGCAGCCTTGTGAACTGGCCTCCCCCAGTGTGAATAAAGTCTCCTGCCTTTCCTCTT
Translation
 MSLPFYQRSHQHYDLSYRNKDLRTTMSHYQQEKKRSAVYTHGSTAYSSRSLAARRQESEAFSQASATSYQQQASQTYSLGASSSSRHSQGSEVSRKTAS

AYDYGYSHG GLTDSSLLLEDYSSKLSPQTKRAKRSLLSGEETGSLPGNYLVPIYSGR RQVHISGIRDSEEERIKEAAAYIAQKTLLASEEAIAASKQS

TASKQSATSKRTTSTLQREETFEKKSRNIAIREKAEELSLKKT LEETQTYHGKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSVAGWPEPRLTW - 

UNI30387 - WYKNQVPINVHANPGKYIIESRYGMHTLEISK KCDFEDTAQYRASAMNVQGELSAYASVVVKR RYKGELDESLLRGGVSMPLSF FA

VTPYGYASKFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEVQWYRNG GAPVSPSKWVQPHWSGDRATLTFSHLNKEDEGLYTIRVRMGEYYE

QYSAYVFVRD DADAEIEGAPAAPLDVVSLDANKDYIIISWKQPAVDGGSPILGYFIDK KCEVGTDTWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAV

NKTGIGLPSRVSEPVAALDPAEKARLKS SHPSAPWTGQIIVTEEEPTE EGVIPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK CDVGAEN

WQRVNTELPVKSPRFALFDLVEGKSYRFRVRCSNSAGVGEPSETTEVTVVGDKLD DIPKAPGKIIPSRNTDTSVVVSWEESRDAKELVGYYIEASVVGS

GKWEPCNNNPVKGSR RFTCHGLTTAQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIG GGGVSPDVWPQLSDTPGGLTDSRGGMNGASPPTSQKDALLG

SNPNKPSPPSSPSSRGQKEVSTVSESVQEPLSSPPQEAAPEEEQSQSEPPKKKKDPVA AVPSAPYDITCLESFRDSMVLGWKQPDTTGGAEITGYYVNY

REVVGEVPGKWREANIKAVSDAAYK ISNLKENTLYQFQVSAMNIAGLGAPSTVSECFKCEEWTIAVPG GPPHSVKLSEVRKNSLVLQWKPPVYSGRTP

VTGYFVDLKEASAKDDQWRGLNEAAIVNKYLR VQGLKEGTSYVFRVRAVNQAGVGKPSDLAGPVVAETRPG GTKEVVVSVDDDGVISLNFECDQMTPK

SEFVWSKDYVPTEDSPRLEVENKGDK KTKMTFKDLGTDDLGTYSCDVTDTDGIASSYLIDEEE EMKRLLALSQEHKFPT TVPTKSELAVEILEKGQV

RFWMQAEKLSSNAKVSYIFNEKEIFEGP KYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQIQDGKATGHSTLVLIGDV VYKKLQKEAEFQRQEWIRKQG

 GPHFAEYLSWEVTGECNVLLKCK VANIKKETHIVWYKDEREISVDEKHDFKDGICTLLITE FSKKDAGFYEVILKDDRGKDKSRLKLVDEA AFQDL

MTEVCKKIA ALSATDLKIQSTAEGIRLYSFVCYYLDDLKVNWSHN NGTGIKYTDRVKSGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLS

GQA AFDEAFAEFQRLK KQAAIAEKN NRARVLGGLPDVVTIQEGK ALNLTCNVWGDPPPEVSWLKNEKPLTSDDHCSLKFEAGKTAFFTISGVSTAD

SGKYGLVVKNKYGSETSDFTVSVFIPEEELRKGAMEPPKGNQKSK

For any suggestions or comments, please send an email to unitrap@crg.es